Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7766 4.1e-07
group 3 medulloblastoma 4002 9.5e-07
primitive neuroectodermal tumor 2957 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 3.0
Disease Target Count Z-score Confidence
Fanconi anemia 56 3.23 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 2.800 9.5e-07
osteosarcoma -2.791 4.1e-07
primitive neuroectodermal tumor 1.200 1.6e-02

Gene RIF (1)

AA Sequence

MMAADIPRVTTPLSSLVQVPQEEDRQEEEVTTMILEDDSWVQEAVLQEDGPESEPFPQSAGKGGPQEEVT      1 - 70
RGPQGALGRLRELCRRWLRPEVHTKEQMLTMLPKEIQAWLQEHRPESSEEAAALVEDLTQTLQDSDFEIQ     71 - 140
SENGENCNQDMFENESRKIFSEMPEGESAQHSDGESDFERDAGIQRLQGHSPGEDHGEVVSQDREVGQLI    141 - 210
GLQGTYLGEKPYECPQCGKTFSRKSHLITHERTHTGEKYYKCDECGKSFSDGSNFSRHQTTHTGEKPYKC    211 - 280
RDCGKSFSRSANLITHQRIHTGEKPFQCAECGKSFSRSPNLIAHQRTHTGEKPYSCPECGKSFGNRSSLN    281 - 350
THQGIHTGEKPYECKECGESFSYNSNLIRHQRIHTGEKPYKCTDCGQRFSQSSALITHRRTHTGEKPYQC    351 - 420
SECGKSFSRSSNLATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMHTGEKPYECLTCGESFSWSSNLL    421 - 490
KHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHLGDKPYRC    491 - 560
PECGKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQRTHMKEKLY                    561 - 614
//

Text Mined References (10)

PMID Year Title