Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.34
PubTator Score 0.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -3.100 1.6e-08
psoriasis -2.400 5.2e-12
osteosarcoma 1.635 4.6e-06
glioblastoma -1.100 1.5e-03
medulloblastoma, large-cell -1.400 8.8e-05
non-small cell lung cancer -1.362 1.2e-10
Common variable immunodeficiency -1.463 2.8e-03
intraductal papillary-mucinous adenoma (... -1.700 9.8e-03
intraductal papillary-mucinous carcinoma... -2.800 6.2e-04
intraductal papillary-mucinous neoplasm ... -3.400 6.3e-05
active Crohn's disease -1.051 2.0e-02
cystic fibrosis 1.200 9.4e-04
subependymal giant cell astrocytoma -1.398 1.5e-02
Breast cancer -1.400 1.9e-09
Pick disease -1.300 2.9e-05
ovarian cancer -2.100 7.9e-11
pituitary cancer -1.100 1.4e-03

Gene RIF (1)

PMID Text
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.

AA Sequence

MLPLEKAFASPRSSPAPPDLPTPGSAAGVQQEEPETIPERTPADLEFSRLRFREFVYQEAAGPHQTLARL      1 - 70
HELCRQWLMPEARSKEQMLELLVLEQFLGILPDKVRPWVVAQYPESCKKAASLVEGLADVLEEPGMLLGS     71 - 140
PAGSSSILSDGVYERHMDPLLLPGELASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVREAKTEEDGPA    141 - 210
NTEQKLKSFPEDPQHLGEWGHLDPAEENLKSYRKLLLWGYQLSQPDAASRLDTEELRLVERDPQGSSLPE    211 - 280
GGRRQESAGCACEEAAPAGVLPELPTEAPPGDALADPPSGTTEEEEEQPGKAPDPQDPQDAESDSATGSQ    281 - 350
RQSVIQQPAPDRGTAKLGTKRPHPEDGDGQSLEGVSSSGDSAGLEAGQGPGADEPGLSRGKPYACGECGE    351 - 420
AFAWLSHLMEHHSSHGGRKRYACQGCWKTFHFSLALAEHQKTHEKEKSYALGGARGPQPSTREAQAGARA    421 - 490
GGPPESVEGEAPPAPPEAQR                                                      491 - 510
//

Text Mined References (7)

PMID Year Title
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.