Property Summary

NCBI Gene PubMed Count 16
PubMed Score 154.29
PubTator Score 91.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 5.2e-05
astrocytic glioma 2597 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Paget's disease of bone 36 0.0 1.0
Disease Target Count Z-score Confidence
Orotic aciduria 18 3.831 1.9
Warburg micro syndrome 18 3.549 1.8
Hepatitis A 11 3.015 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.100 2.0e-02
osteosarcoma 1.119 5.2e-05

Gene RIF (9)

AA Sequence

MPRVHNIKKSLTPHISCVTNESDNLLDFLPDRLRAKLLPFQKDGIIFALKRNGRCMVADEMGLGKTIQAI      1 - 70
GITYFYKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVRRMSTSKVTVLGYGLLTADAK     71 - 140
TLIDALNNQNFKVVIVDESHYMKSRNATRSRILLPIVQKARRAILLTGTPALGRPEELFMQIEALFPQKF    141 - 210
GRWTDYAKRYCNAHIRYFGKRPQWDCRGASNLNELHQLLSDIMIRRLKTEVLTQLPPKVRQRIPFDLPSA    211 - 280
AAKELNTSFEEWEKIMRTPNSGAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSM    281 - 350
LQACTEAVIENKTRYIRIDGSVSSSERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWD    351 - 420
PGHIKQAEDRAHRIGQCSSVNIHYLIANGTLDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEGDKEKWDFL    421 - 490
QFAEAWTPNDSSEELRKEALFTHFEKEKQHDIRSFFVPQPKKRQLMTSCDESKRFREENTVVSSDPTKTA    491 - 560
ARDIIDYESDVEPETKRLKLAASEDHCSPSEETPSQSKQIRTPLVESVQEAKAQLTTPAFPVEGWQCSLC    561 - 630
TYINNSELPYCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQALAQSEPGQLADS    631 - 700
KEETPKIEKEDGLTSQPGNEQWKSSDTLPVYDTLMFCASRNTDRIHIYTKDGKQMSCNFIPLDIKLDLWE    701 - 770
DLPASFQLKQYRSLILRFVREWSSLTAMKQRIIRKSGQLFCSPILALEEITKQQTKQNCTKRYITKEDVA    771 - 840
VASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGYLQAVDNEGNP    841 - 910
LCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLR    911 - 980
DAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTA    981 - 1050
RQAKERSQVRRQSLASKHGSDITRFLVKK                                            1051 - 1079
//

Text Mined References (20)

PMID Year Title