Property Summary

NCBI Gene PubMed Count 22
PubMed Score 39.25
PubTator Score 20.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.877 3.2e-06
acute quadriplegic myopathy 1.093 6.4e-04
intraductal papillary-mucinous adenoma (... 1.100 4.9e-04
intraductal papillary-mucinous carcinoma... 1.200 7.5e-05
active ulcerative colitis -1.104 2.0e-02
Pick disease -1.400 1.4e-05
progressive supranuclear palsy -1.400 1.5e-02
ovarian cancer 2.100 7.7e-07

Pathway (1)

Gene RIF (3)

PMID Text
23666063 ZRANB2 is part of the supraspliceosome and causes differential splicing of numerous primary transcripts, some of which might have a role in cancer.
19052380 Crystallization of a ZRANB2-RNA complex
12657633 sites responsible for MRNA binding have been characterized.

AA Sequence

MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQ      1 - 70
CKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESDGEYDEFGRKKKKYRGKAVG     71 - 140
PASILKEVEDKESEGEEEDEDEDLSKYKLDEDEDEDDADLSKYNLDASEEEDSNKKKSNRRSRSKSRSSH    141 - 210
SRSSSRSSSPSSSRSRSRSRSRSSSSSQSRSRSSSRERSRSRGSKSRSSSRSHRGSSSPRKRSYSSSSSS    211 - 280
PERNRKRSRSRSSSSGDRKKRRTRSRSPERRHRSSSGSSHSGSRSSSKKK                        281 - 330
//

Text Mined References (35)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23666063 2013 ZRANB2 localizes to supraspliceosomes and influences the alternative splicing of multiple genes in the transcriptome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19052380 2008 Crystallization of a ZRANB2-RNA complex.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16982639 2006 XE7: a novel splicing factor that interacts with ASF/SF2 and ZNF265.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559993 2003 Regulation of alternative splicing by SRrp86 and its interacting proteins.
12657633 2003 The structure of the zinc finger domain from human splicing factor ZNF265 fold.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11448987 2001 ZNF265--a novel spliceosomal protein able to induce alternative splicing.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10773668 2000 Chromosome localization and characterization of the mouse and human zinc finger protein 265 gene.
9931435 1998 Identification, characterization and mapping of the human ZIS (zinc-finger, splicing) gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.