Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.96
PubTator Score 1.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ 1.400 3.8e-05
osteosarcoma -1.647 1.5e-03
sonic hedgehog group medulloblastoma 1.400 2.1e-04

Gene RIF (4)

AA Sequence

MGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAA      1 - 70
APAAPAAPRSRSLGGAVGSVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPR     71 - 140
LVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGD    141 - 210
TIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD                                          211 - 242
//

Text Mined References (15)

PMID Year Title