Property Summary

NCBI Gene PubMed Count 37
PubMed Score 38.02
PubTator Score 38.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (28)

AA Sequence

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM      1 - 70
SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS                   71 - 126
//

Text Mined References (37)

PMID Year Title