Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.74
PubTator Score 0.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.6e-03
ovarian cancer 8520 1.8e-02
subependymal giant cell astrocytoma 2287 2.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer 1.200 1.8e-02
psoriasis -1.200 2.6e-03
subependymal giant cell astrocytoma 1.092 2.2e-02

Gene RIF (1)

AA Sequence

MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDGEEGSGQRPEE      1 - 70
IPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQETDSSLVVKEAKVGEPEVKEE     71 - 140
KVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGECVKEEKDFLKKEIVDDTKVKEEPPINHPVG    141 - 210
CKRKLAMSRCETCGTEEAKYRCPRCMRYSCSLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLLSDYRF    211 - 280
LEDVARTADHISRDAFLKRPISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKL    281 - 350
QFPQSQAEYIEKRVPDDKTINEILKPYIDPEKSDPVIRQRLKAYIRSQTGVQILMKIEYMQQNLVRYYEL    351 - 420
DPYKSLLDNLRNKVIIEYPTLHVVLKGSNNDMKVLHQVKSESTKNVGNEN                        421 - 470
//

Text Mined References (20)

PMID Year Title