Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.85
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.300 2.8e-02
oligodendroglioma 1.300 4.0e-02
psoriasis -1.400 7.3e-04
group 4 medulloblastoma 2.100 1.4e-06
atypical teratoid / rhabdoid tumor 1.600 2.0e-06
glioblastoma 1.300 1.6e-03
medulloblastoma, large-cell 1.900 3.7e-05
primitive neuroectodermal tumor 1.400 1.8e-04
lung cancer 1.800 2.0e-04
cystic fibrosis 1.300 3.0e-04
non primary Sjogren syndrome sicca -1.500 2.0e-02
mucosa-associated lymphoid tissue lympho... -1.032 6.1e-03
ovarian cancer 1.100 1.4e-08

Gene RIF (3)

PMID Text
22082156 Knockdown of zinc finger protein 93 (ZNF93) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19742314 zinc finger proteins, and ZNF93 in particular, are involved in resistance to ET-743 and PM00104

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGIVVSKPDLIAHLEQGKKPLTMKRHEM      1 - 70
VANPSVICSHFAQDLWPEQNIKDSFQKVILRRYEKRGHGNLQLIKRCESVDECKVHTGGYNGLNQCSTTT     71 - 140
QSKVFQCDKYGKVFHKFSNSNRHNIRHTEKKPFKCIECGKAFNQFSTLITHKKIHTGEKPYICEECGKAF    141 - 210
KYSSALNTHKRIHTGEKPYKCDKCDKAFIASSTLSKHEIIHTGKKPYKCEECGKAFNQSSTLTKHKKIHT    211 - 280
GEKPYKCEECGKAFNQSSTLTKHKKIHTGEKPYVCEECGKAFKYSRILTTHKRIHTGEKPYKCNKCGKAF    281 - 350
IASSTLSRHEFIHMGKKHYKCEECGKAFIWSSVLTRHKRVHTGEKPYKCEECGKAFKYSSTLSSHKRSHT    351 - 420
GEKPYKCEECGKAFVASSTLSKHEIIHTGKKPYKCEECGKAFNQSSSLTKHKKIHTGEKPYKCEECGKAF    421 - 490
NQSSSLTKHKKIHTGEKPYKCEECGKAFNQSSTLIKHKKIHTREKPYKCEECGKAFHLSTHLTTHKILHT    491 - 560
GEKPYRCRECGKAFNHSATLSSHKKIHSGEKPYECDKCGKAFISPSSLSRHEIIHTGEKP              561 - 620
//

Text Mined References (11)

PMID Year Title
25274305 2014 An evolutionary arms race between KRAB zinc-finger genes ZNF91/93 and SVA/L1 retrotransposons.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19742314 2009 ZNF93 increases resistance to ET-743 (Trabectedin; Yondelis) and PM00104 (Zalypsis) in human cancer cell lines.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8467795 1993 Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.
2023909 1991 The evolutionarily conserved Krüppel-associated box domain defines a subfamily of eukaryotic multifingered proteins.