Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.800 1.2e-02
glioblastoma multiforme 1.200 2.1e-15
group 3 medulloblastoma 1.500 5.2e-03
non-small cell lung cancer -1.058 1.6e-10
osteosarcoma -1.967 2.5e-03
ovarian cancer -1.700 2.0e-05
Pick disease -1.300 4.4e-04
progressive supranuclear palsy -1.500 1.1e-02
psoriasis -1.900 7.4e-08
tuberculosis and treatment for 3 months 1.100 1.3e-04

AA Sequence

MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHT      1 - 70
YECNFVDSLFTQKEKANIGTEHYKCSERGKAFHQGLHFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQ     71 - 140
RIHTGEKPYKCNECGKVFHNMSHLAQHRRIHTGEKPYKCNECGKVFNQISHLAQHQRIHTGEKPYKCNEC    141 - 210
GKVFHQISHLAQHRTIHTGEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQHQ    211 - 280
RIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNEC    281 - 350
GKVFSRNSYLAQHLIIHAGEKPYKCDECDKAFSQNSHLVQHHRIHTGEKPYKCDECGKVFSQNSYLAYHW    351 - 420
RIHTGEKAYKCNECGKVFGLNSSLAHHRKIHTGEKPFKCNECGKAFSMRSSLTNHHAIHTGEKHFKCNEC    421 - 490
GKLFRDNSYLVRHQRFHAGKKSNTCN                                                491 - 516
//

Text Mined References (12)

PMID Year Title