Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.800 1.2e-02
psoriasis -1.900 7.4e-08
glioblastoma multiforme 1.200 2.1e-15
osteosarcoma -1.967 2.5e-03
group 3 medulloblastoma 1.500 5.2e-03
tuberculosis and treatment for 3 months 1.100 1.3e-04
non-small cell lung cancer -1.058 1.6e-10
Pick disease -1.300 4.4e-04
progressive supranuclear palsy -1.500 1.1e-02
ovarian cancer 2.200 2.7e-05

AA Sequence

MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLVSPPQRISSTVKTHISHT      1 - 70
YECNFVDSLFTQKEKANIGTEHYKCSERGKAFHQGLHFTIHQIIHTKETQFKCDICGKIFNKKSNLASHQ     71 - 140
RIHTGEKPYKCNECGKVFHNMSHLAQHRRIHTGEKPYKCNECGKVFNQISHLAQHQRIHTGEKPYKCNEC    141 - 210
GKVFHQISHLAQHRTIHTGEKPYECNKCGKVFSRNSYLVQHLIIHTGEKPYRCNVCGKVFHHISHLAQHQ    211 - 280
RIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNECGKVFSHKSSLVNHWRIHTGEKPYKCNEC    281 - 350
GKVFSRNSYLAQHLIIHAGEKPYKCDECDKAFSQNSHLVQHHRIHTGEKPYKCDECGKVFSQNSYLAYHW    351 - 420
RIHTGEKAYKCNECGKVFGLNSSLAHHRKIHTGEKPFKCNECGKAFSMRSSLTNHHAIHTGEKHFKCNEC    421 - 490
GKLFRDNSYLVRHQRFHAGKKSNTCN                                                491 - 516
//

Text Mined References (12)

PMID Year Title
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16237761 2005 Screening of hepatocyte proteins binding to F protein of hepatitis C virus by yeast two-hybrid system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8088807 1994 Assignment of the human ZNF83 (HPF1) zinc finger gene to chromosome 19q13.3-q13.4.
7865130 1995 Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937.
2505992 The human genome contains hundreds of genes coding for finger proteins of the Krüppel type.