Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.30
PubTator Score 7.95

Knowledge Summary


No data available


  Differential Expression (2)

Disease log2 FC p
pilocytic astrocytoma 1.100 2.1e-06
ovarian cancer -1.200 5.0e-08

AA Sequence

IHTGDKPYKCSDCGKGFTQKSVLSMHRNIHT                                           631 - 661

Text Mined References (12)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15121780 2004 Zinc finger 81 (ZNF81) mutations associated with X-linked mental retardation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10398246 1999 Four families (MRX43, MRX44, MRX45, MRX52) with nonspecific X-linked mental retardation: clinical and psychometric data and results of linkage analysis.
8938429 1996 Long-range map of a 3.5-Mb region in Xp11.23-22 with a sequence-ready map from a 1.1-Mb gene-rich interval.
8530079 1995 A high-resolution map of genes, microsatellite markers, and new dinucleotide repeats from UBE1 to the GATA locus in the region Xp11.23.
8507979 1993 A novel X-linked member of the human zinc finger protein gene family: isolation, mapping, and expression.
8088827 1994 A 1.8-Mb YAC contig in Xp11.23: identification of CpG islands and physical mapping of CA repeats in a region of high gene density.
8088799 1994 Physical mapping in a YAC contig of 11 markers on the human X chromosome in Xp11.23.
8088786 1994 Clustered organization of Krüppel zinc-finger genes at Xp11.23, flanking a translocation breakpoint at OATL1: a physical map with locus assignments for ZNF21, ZNF41, ZNF81, and ELK1.