Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
Pick disease 1856 3.6e-08
osteosarcoma 7766 3.2e-07
psoriasis 6514 7.7e-04
astrocytoma 1113 3.0e-03
ependymoma 4559 4.1e-03
progressive supranuclear palsy 656 5.4e-03
Alzheimer's disease 640 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 437 0.0 3.0
Disease Target Count Z-score Confidence
Parkinson's disease 378 4.088 2.0

Gene RIF (1)

AA Sequence

MEEAAAAPISPWTMAATIQAMERKIESQAAHLLSLEGQTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTL      1 - 70
LQEYGLLQRRLENVENLLHNRNFWILRLPPGSKGESPKTTPSPSPRSSPRLNKGRSPATGAALTPRFQMF     71 - 140
LWTPVQMQKLRPSRD                                                           141 - 155
//

Text Mined References (9)

PMID Year Title