Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.20
PubTator Score 10.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
urothelial carcinoma -1.800 2.9e-02
esophageal adenocarcinoma -3.200 1.9e-02
non-small cell lung cancer 2.555 1.3e-11
interstitial cystitis -3.700 1.5e-05
non primary Sjogren syndrome sicca 1.300 1.9e-02
nasopharyngeal carcinoma -2.500 4.3e-04
lung adenocarcinoma 1.068 3.9e-02
Endometriosis -1.509 6.7e-03
spina bifida -3.116 3.6e-02
Breast cancer -1.900 1.7e-09
ductal carcinoma in situ 1.300 4.6e-02
pituitary cancer -1.500 1.8e-03

Gene RIF (6)

PMID Text
25228645 ZNF750 thus controls differentiation in concert with RCOR1 and CTBP1/2 by acting with either KDM1A to repress progenitor genes or KLF4 to induce differentiation genes.
24005976 Suggest no connection of ZNF750 variants with psoriasis or its subphenotypes.
22936986 ZNF750 was specifically expressed in the epidermal suprabasal layers and its expression was augmented during differentiation, both in human skin and in-vitro, peaking in the granular layer.
22364861 ZNF750 directly links a tissue-specifying factor, p63, to an effector of terminal differentiation, KLF4.
22185198 Two haplotypes of ZNF750 and rare 5' regulatory variants of ZNF750 were found to be associated with psoriasis.
18256691 ZNF750 mutations could contribute to psoriasis susceptibility.

AA Sequence

MSLLKERKPKKPHYIPRPPGKPFKYKCFQCPFTCNEKSHLFNHMKYGLCKNSITLVSEQDRVPKCPKSNS      1 - 70
LDPKQTNQPDATAKPASSKSVANGLSAFDSKLQHSSAREDIKENLELQARGTHRCLGQKPALHRASPCKS     71 - 140
PAPEAALGAQPALEGAARPSAFVPVGEHRLKGPDNAEAPETLALHNPTAKAVSFHTKSAFHTPGYPWKAG    141 - 210
SPFLPPEFPHKISSTKGLGAISPYMHPTIPEYPPHFYTEHGLATIYSPYLLAGSSPECDAPLLSVYGTQD    211 - 280
PRHFLPHPGPIPKHLAPSPATYDHYRFFQQYPSNLPIPYGFYRPESAFSSYGLRLPPVTGLTRDQSSHLL    281 - 350
EEATLVYPASSPSRLNPSDPNRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATGSPGRPSPTDF    351 - 420
MQTSQTCEGLYDLSNKAASSALGRLYPPEQSLTAFRPVKKSTECLPAQAAETTAESPVSLNVVNGDPPAP    421 - 490
TGSASLVSEAAPSSPDDSSGMGPLNLSKKSEINLAATHEPTYQGSPQAETASFSELQDLPLNLSVKDPCN    491 - 560
TQAPRPAFPGRPRAAEPAAAVPQKTGTEGSEDGPSHPETKPGSLDGDGAPPTGPGEEAPDACAVDSSEEQ    561 - 630
KQTAAVALCQLAAYSPRNIRVGDGDAAAPEPACRQDTPTLSSMESQEAQCDLRPKGQKRTSLRDAGKSQQ    631 - 700
GAKKAKLQDTARVFTLRRRARVS                                                   701 - 723
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25228645 2014 ZNF750 interacts with KLF4 and RCOR1, KDM1A, and CTBP1/2 chromatin regulators to repress epidermal progenitor genes and induce differentiation genes.
24005976 2014 Common variants of ZNF750, RPTOR and TRAF3IP2 genes and psoriasis risk.
22936986 2012 ZNF750 is expressed in differentiated keratinocytes and regulates epidermal late differentiation genes.
22364861 2012 ZNF750 is a p63 target gene that induces KLF4 to drive terminal epidermal differentiation.
22185198 2011 Association analysis identifies ZNF750 regulatory variants in psoriasis.
18256691 2008 A promoter sequence variant of ZNF750 is linked with familial psoriasis.
16751772 2006 Seborrhea-like dermatitis with psoriasiform elements caused by a mutation in ZNF750, encoding a putative C2H2 zinc finger protein.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.