Property Summary

NCBI Gene PubMed Count 5
PubMed Score 24.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4002 1.3e-03
Disease Target Count Z-score Confidence
tuberculosis 1963 5.086 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.3e-03

AA Sequence

MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSDKSRSRKDDDS      1 - 70
LSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHILIHTGEKPFECDICDMRFIQ     71 - 140
KYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQGCQSKTSDGQFSL                     141 - 193
//

Text Mined References (10)

PMID Year Title