Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 480 6.4e-03


  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... -1.012 6.4e-03

AA Sequence

HAGQQPYKWEKIGKAFNQSSHLTTDKITHIGEKSYKCE                                    701 - 738

Text Mined References (6)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
15869325 2005 A scan for positively selected genes in the genomes of humans and chimpanzees.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.