Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.17
PubTator Score 6.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.200 6.7e-06
astrocytic glioma 1.900 3.4e-02
ependymoma 2.000 6.3e-03
cutaneous lupus erythematosus -1.600 1.5e-02
psoriasis -4.600 6.6e-06
group 4 medulloblastoma 2.600 2.2e-04
medulloblastoma, large-cell 1.200 2.4e-04
primitive neuroectodermal tumor 1.500 2.1e-04
adrenocortical adenoma 1.701 2.2e-02
non-small cell lung cancer 1.043 2.4e-05
intraductal papillary-mucinous adenoma (... -2.000 9.8e-04
intraductal papillary-mucinous neoplasm ... -3.000 2.7e-03
lung cancer 1.800 1.7e-03
interstitial cystitis -2.400 3.2e-05
cystic fibrosis -1.400 1.3e-02
invasive ductal carcinoma -1.011 2.1e-03
lung carcinoma 2.100 1.4e-32
Pick disease -1.200 5.9e-04
Breast cancer -2.500 1.9e-05
acute myeloid leukemia -1.400 3.6e-02
ovarian cancer -2.100 2.7e-03

Gene RIF (3)

PMID Text
26188516 The KCTD5/cullin3 complex stabilizes ZNF711 transcription factor.
21384559 A total of six novel and 11 known single nucleotide polymorphisms were identified. Further studies are warranted to analyze the candidate genes at Xq11.1-q21.33.
20346720 A functional link between the histone demethylase PHF8 and the transcription factor ZNF711 in X-linked mental retardation is reported.

AA Sequence

MDSGGGSLGLHTPDSRMAHTMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEV      1 - 70
VHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGH     71 - 140
LEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAAGGVPGSTVTIKTEDDDDDDVKSTSEDYLMISLDD    141 - 210
VGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVL    211 - 280
DQSRMQREKMVYMAVKDSSQEEDDIRDERRVSRRYEDCQASGNTLDSALESRSSTAAQYLQICDGINTNK    281 - 350
VLKQKAKKRRRGETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCD    351 - 420
FTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQGL    421 - 490
LNRHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCIFRCADQSNLKTHIKSKHGNNL    491 - 560
PYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHR    561 - 630
PSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQPLKCKRCKRGFRQQNELKKHMKTHTG    631 - 700
RKIYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEALM             701 - 761
//

Text Mined References (13)

PMID Year Title
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21384559 2011 Fine mapping of Xq11.1-q21.33 and mutation screening of RPS6KA6, ZNF711, ACSL4, DLG3, and IL1RAPL2 for autism spectrum disorders (ASD).
20346720 2010 A functional link between the histone demethylase PHF8 and the transcription factor ZNF711 in X-linked mental retardation.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9491611 1998 Molecular evolution of the ZFY and ZNF6 gene families.
8733041 1996 Localisation of two candidate genes for mental retardation using a YAC physical map of the Xq21.1-21.2 subbands.
1923752 1991 An X-linked zinc finger gene mapping to Xq21.1-q21.3 closely related to ZFX and ZFY: possible origins from a common ancestral gene.