Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.42
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 8.5e-05
Breast cancer 1.100 7.0e-04
glioblastoma -1.500 6.7e-04
group 4 medulloblastoma -1.100 1.7e-03
lung carcinoma 1.200 3.9e-17
medulloblastoma, large-cell -1.800 3.2e-04
ovarian cancer -1.200 2.3e-04
pituitary cancer 1.100 9.3e-04

Gene RIF (1)

AA Sequence

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE      1 - 70
LADVQA                                                                     71 - 76
//

Text Mined References (8)

PMID Year Title