Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.31
PubTator Score 1.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
osteosarcoma 3.200 4.8e-08
medulloblastoma 2.200 1.4e-05
atypical teratoid / rhabdoid tumor 1.400 2.2e-03
glioblastoma 1.100 2.9e-03
medulloblastoma, large-cell 1.900 9.7e-05
primitive neuroectodermal tumor 1.100 3.7e-04
Atopic dermatitis -1.100 4.3e-04
non-small cell lung cancer -1.088 7.7e-07
intraductal papillary-mucinous carcinoma... -1.600 3.5e-03
intraductal papillary-mucinous neoplasm ... -2.000 5.0e-04
ulcerative colitis -2.000 2.1e-06
interstitial cystitis -1.800 4.2e-04
lung adenocarcinoma -1.200 1.1e-11
psoriasis -1.200 8.3e-15
subependymal giant cell astrocytoma -2.458 4.7e-02
Pick disease 1.300 2.1e-05
ovarian cancer 1.400 3.1e-08
head and neck cancer -1.100 1.7e-02

AA Sequence

MTFTFQSEDLKRDCGKKMSHQHVFSLAMEEDVKTADTKKASRILDHEKENTRSICLLEQKRKVVSSNIDV      1 - 70
PPARKSSEELDMDKVTAAMVLTSLSTSPLVRSPPVRPNESLSGSWKEGGCVPSSTSSSGYWSWSAPSDQS     71 - 140
NPSTPSPPLSADSFKPFRSPAQPDDGIDEAEASNLLFDEPIPRKRKNSMKVMFKCLWKNCGKVLSTAAGI    141 - 210
QKHIRTIHLGRVGDSDYSDGEEDFYYTEIKLNTDSVADGLSSLAPVSPSQSLASPPTFPIPDSSRTETPC    211 - 280
AKTETKLMTPLSRSAPTTLYLVHTDHAYQATPPVTIPGSAKFTPNGSSFSISWQSPPVTFTGIPVSPTHH    281 - 350
PVGTGEQRQHAHTVLSSPPRGTVSLRKPRGEGKKCRKVYGMENRDMWCTACRWKKACQRFLD            351 - 412
//

Text Mined References (5)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.