Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.47
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4002 1.6e-04
lung cancer 4607 2.8e-03
ovarian cancer 8297 4.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Kidney cancer 2548 0.0 0.5

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.500 1.6e-04
lung cancer 1.100 2.8e-03
ovarian cancer -1.100 4.4e-03

Gene RIF (1)

AA Sequence

MEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVFKPELISRLEQGEEPWVLDLQG      1 - 70
AEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRISPQDFPQNPGFGDVSDSEVWLDSHLGSPG     71 - 140
LKVTGFTFQNNCLNEETVVPKTFTKDAPQGCKELGSSGLDCQPLESQGESAEGMSQRCEECGKGIRATSD    141 - 210
IALHWEINTQKISRCQECQKKLSDCLQGKHTNNCHGEKPYECAECGKVFRLCSQLNQHQRIHTGEKPFKC    211 - 280
TECGKAFRLSSKLIQHQRIHTGEKPYRCEECGKAFGQSSSLIHHQRIHTGERPYGCRECGKAFSQQSQLV    281 - 350
RHQRTHTGERPYPCKECGKAFSQSSTLAQHQRMHTGEKAQILKASDSPSLVAHQRIHAVEKPFKCDECGK    351 - 420
AFRWISRLSQHQLIHTGEKPYKCNKCTKAFGCSSRLIRHQRTHTGEKPFKCDECGKGFVQGSHLIQHQRI    421 - 490
HTGEKPYVCNDCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSMSTQLTIHQRVHTGERPYKCNECGK    491 - 560
AFSQNSTLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQRIHTRAQWFYEYGNALEGSTFVSRKKVNTI    561 - 630
KKLHQCEDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG                  631 - 686
//

Text Mined References (17)

PMID Year Title