Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.07
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7766 4.8e-06
lung cancer 4607 1.5e-03
group 3 medulloblastoma 4002 4.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 4.2e-03
lung cancer 1.800 1.5e-03
osteosarcoma -1.538 4.8e-06

AA Sequence

MEPGGEPTGAKESSTLMESLAAVKAAFLAQAPSGSRSAEVQAAQSTEPAAEAGAPEGEGHRGGPPRALGS      1 - 70
LGLCENQEARERPGGSPRGPVTSEKTGGQSGLESDVPPNAGPGAEGGGSWKGRPFPCGACGRSFKCSSDA     71 - 140
AKHRSIHSGEKPYECSDCGKAFIHSSHVVRHQRAHSGERPYACAECGKAFGQSFNLLRHQRVHTGEKPYA    141 - 210
CADCGKAFGQRSDAAKHRRTHTGERLYACGECGKRFLHSSNVVRHRRTHHGENPYECRECGQAFSQSSNL    211 - 280
LQHQRVHTGERPFACQDCGRAFSRSSFLREHRRIHTGEKPHQCGHCGRAFRALSGFFRHQRLHTGEKPFR    281 - 350
CTECGRAFRLSFHLIQHRRVHGAE                                                  351 - 374
//

Text Mined References (4)

PMID Year Title