Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.27
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteitis Deformans 11 0.0 0.0
Disease Target Count
PAGET DISEASE OF BONE 6 1
Disease Target Count P-value
glioblastoma 5792 2.3e-06
medulloblastoma, large-cell 6241 1.4e-04
group 4 medulloblastoma 1855 3.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Paget's disease of bone 36 4.751 2.4
Giant cell tumor 5 4.075 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.200 2.3e-06
group 4 medulloblastoma 1.300 3.6e-04
medulloblastoma, large-cell 1.400 1.4e-04

Gene RIF (2)

AA Sequence

MGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEENEGPGGPGKPEPGVGSESEDTAAASAGDGPGVPAQAS      1 - 70
DHGLPPPDISVVSVIVKNTVCPEQSEALAGGSAGDGAQAAGVTKEGPVGPHRMQNGFGSPEPSLPGTPHS     71 - 140
PAPPSGGTWKEKGMEGKTPLDLFAHFGPEPGDHSDPLPPSAPSPTREGALTPPPFPSSFELAQENGPGMQ    141 - 210
PPVSSPPLGALKQESCSPHHPQVLAQQGSGSSPKATDIPASASPPPVAGVPFFKQSPGHQSPLASPKVPV    211 - 280
CQPLKEEDDDEGPVDKSSPGSPQSPSSGAEAADEDSNDSPASSSSRPLKVRIKTIKTSCGNITRTVTQVP    281 - 350
SDPDPPAPLAEGAFLAEASLLKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVA    351 - 420
RKAVVLPGGTATSPKMIAKNVLGLVPQALPKADGRAGLGTGGQKVNGASVVMVQPSKTATGPSTGGGTVI    421 - 490
SRTQSSLVEAFNKILNSKNLLPAYRPNLSPPAEAGLALPPTGYRCLECGDAFSLEKSLARHYDRRSMRIE    491 - 560
VTCNHCARRLVFFNKCSLLLHAREHKDKGLVMQCSHLVMRPVALDQMVGQPDITPLLPVAVPPVSGPLAL    561 - 630
PALGKGEGAITSSAITTVAAEAPVLPLSTEPPAAPATSAYTCFRCLECKEQCRDKAGMAAHFQQLGPPAP    631 - 700
GATSNVCPTCPMMLPNRCSFSAHQRMHKNRPPHVCPECGGNFLQANFQTHLREACLHVSRRVGYRCPSCS    701 - 770
VVFGGVNSIKSHIQTSHCEVFHKCPICPMAFKSGPSAHAHLYSQHPSFQTQQAKLIYKCAMCDTVFTHKP    771 - 840
LLSSHFDQHLLPQRVSVFKCPSCPLLFAQKRTMLEHLKNTHQSGRLEETAGKGAGGALLTPKTEPEELAV    841 - 910
SQGGAAPATEESSSSSEEEEVPSSPEPPRPAKRPRRELGSKGLKGGGGGPGGWTCGLCHSWFPERDEYVA    911 - 980
HMKKEHGKSVKKFPCRLCERSFCSAPSLRRHVRVNHEGIKRVYPCRYCTEGKRTFSSRLILEKHVQVRHG    981 - 1050
LQLGAQSPGRGTTLARGSSARAQGPGRKRRQSSDSCSEEPDSTTPPAKSPRGGPGSGGHGPLRYRSSSST   1051 - 1120
EQSLMMGLRVEDGAQQCLDCGLCFASPGSLSRHRFISHKKRRGVGKASALGLGDGEEEAPPSRSDPDGGD   1121 - 1190
SPLPASGGPLTCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN                          1191 - 1237
//

Text Mined References (25)

PMID Year Title