Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.13
PubTator Score 2.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma 1.200 2.5e-14
glioblastoma 1.400 1.5e-06
oligodendroglioma 1.100 1.6e-10
osteosarcoma 2.516 1.0e-04
group 4 medulloblastoma 1.500 4.5e-04
atypical teratoid / rhabdoid tumor 1.100 4.0e-04
primitive neuroectodermal tumor 1.700 1.7e-04
non-small cell lung cancer -1.270 2.4e-09
intraductal papillary-mucinous adenoma (... -1.100 2.6e-02
intraductal papillary-mucinous carcinoma... -2.300 9.4e-04
intraductal papillary-mucinous neoplasm ... -2.700 7.8e-04
interstitial cystitis -1.500 1.1e-03
pediatric high grade glioma 1.200 1.0e-03
pilocytic astrocytoma 1.200 6.8e-07
psoriasis -1.600 3.6e-15
breast carcinoma -1.500 8.4e-33
spina bifida -1.058 1.6e-02
Breast cancer -2.800 3.6e-10
ductal carcinoma in situ -1.200 1.3e-02
invasive ductal carcinoma -2.000 4.9e-03

Gene RIF (1)

PMID Text
25504438 our results demonstrate that ZNF677 is trancriptionally regulated by methylation in non-small cell lung cancers and suggest that ZNF677 has tumor cell growth suppressing properties

AA Sequence

MALSQGLFTFKDVAIEFSQEEWECLDPAQRALYRDVMLENYRNLLSLDEDNIPPEDDISVGFTSKGLSPK      1 - 70
ENNKEELYHLVILERKESHGINNFDLKEVWENMPKFDSLWDYDVKNYKGMPLTCNKNLTHRKDQQHNKSS     71 - 140
IHFSLKQSVSIRDSAHQYFIHDKPFIRNLLKLKNNIRYAGNKYVKCFENKIGLSLQAQLAELQRFQTGEK    141 - 210
MYECNPVEKSINSSSVSPLPPCVKNICNKYRKILKYPLLHTQYGRTHIREKSYKCNDCGKAFSKSSNLTN    211 - 280
HQRIHSGQRPYKCNECGKAFNQCSNLTRHQRVHTGEKPYQCNICGKVCSQNSNLASHQRMHTGEKPYKCN    281 - 350
ECGKAFIQRSHLWGHERIHTGEKPYKCNECDKAFAERSSLTQHKRIHTGEKPYICNECGKAFKQCSHLTR    351 - 420
HQNIHPGEKPHKCNVCGRAFIQSSSLVEHQRIHTGEKPYKCNKCDKAFIKRSHLWGHQRTHTGEKPYKCT    421 - 490
ECGKAFTERSNLTQHKKIHTGEKPYKCTECGKAFTQFANLTRHQKIHIEKKHCKHNIHGNALFQSSNLGD    491 - 560
HQKSYNREKHIKYNETKIKYSSCT                                                  561 - 584
//

Text Mined References (4)

PMID Year Title
25504438 2015 DNA methylation transcriptionally regulates the putative tumor cell growth suppressor ZNF677 in non-small cell lung cancers.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.