Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.68
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Thyroid Diseases 24 0.0 0.0
Disease Target Count P-value
psoriasis 6694 7.0e-10
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
lung cancer 4740 0.0 0.8
Disease Target Count Z-score Confidence
ACTH-secreting pituitary adenoma 9 3.699 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 7.0e-10

Gene RIF (2)

AA Sequence

MLENYRNLVFLGIAAFKPDLIIFLEQGKEPWNMKRHEMVEEPPVICSHFSQEFWPEQGIEDSFQKMILRR      1 - 70
YDKCGHENLHLKISCTNVDECNVHKEGYNKLNQSLTTTQSKVFQCGKYANVFHKCSNSNRHKIRHTGEKG     71 - 140
LKCKEYVRSFCMLSHLSQHERIYTRENSYKCEENGKAFNWSSTLTYYKSIHTGEKPYKCEECGKAFSKFS    141 - 210
ILTKHKVIHTGEKPYKCEECGKAFNRSSILTKHKIIHTGEKPYKCEECGKGFSSVSTLNTHKAIHAEEKP    211 - 280
YKCEECGKASNSSSKLMEHKRIHTGEKPYKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFNRSS    281 - 350
ILTKHKIIHTGEKPYKCEGCGKAFSKVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHKRIHTGEKP    351 - 420
YKCEECGKAFSWSSSLTEHKRIHAGEKPYKCEECGKAFTWSSSFTKHKRIHAAEKPYKCEECGKGFSTFS    421 - 490
ILTKHKIIHTGEKRYKCEECGKAFSWSSILTEHKIIHTGEKPYKCEECGKAFSRSSSLTRHKRIHTGEKP    491 - 560
YKCEECGKAFKSSSTVSYHKKIHTGENP                                              561 - 588
//

Text Mined References (5)

PMID Year Title