Property Summary

NCBI Gene PubMed Count 5
PubMed Score 35.12
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 2.3e-08
osteosarcoma 7950 2.4e-08
psoriasis 6694 2.7e-06
lung cancer 4740 1.1e-04
spina bifida 1074 1.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.900 2.3e-08
lung cancer 2.200 1.1e-04
osteosarcoma -3.076 2.4e-08
psoriasis -4.000 2.7e-06
spina bifida -1.063 1.7e-02

Gene RIF (1)

AA Sequence

MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEKEPLTVKRHEM      1 - 70
VNEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVDECKLHKGGYNGLNQCLPTMQ     71 - 140
SKMFQCDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYTKVNFCKCEECEKAVN    141 - 210
QSSKLTKHKRIYTCEKLYKCQECDRTFNQFSNLTEYKKDYAREKPYKCEECGKAFNQSSHLTTHKIIHTG    211 - 280
EKPYKCEECGKAFNQFSNLTTHKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFN    281 - 350
RSSKLTEHKNIHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG    351 - 420
EKPYKCEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPYKCEECGKAFK    421 - 490
HSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCERCDKAFNQSANLTKHKKIHTG    491 - 560
EKLQNWNV                                                                  561 - 568
//

Text Mined References (6)

PMID Year Title