Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.76
PubTator Score 2.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 2.336 3.3e-06
intraductal papillary-mucinous carcinoma... 1.100 2.5e-03
group 4 medulloblastoma 1.200 4.3e-04
posterior fossa group B ependymoma 1.100 1.1e-09
ovarian cancer 1.300 5.3e-03

Gene RIF (1)

PMID Text
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MIYKCPMCREFFSERADLFMHQKIHTAEKPHKCDKCDKGFFHISELHIHWRDHTGEKVYKCDDCGKDFST      1 - 70
TTKLNRHKKIHTVEKPYKCYECGKAFNWSSHLQIHMRVHTGEKPYVCSECGRGFSNSSNLCMHQRVHTGE     71 - 140
KPFKCEECGKAFRHTSSLCMHQRVHTGEKPYKCYECGKAFSQSSSLCIHQRVHTGEKPYRCCGCGKAFSQ    141 - 210
SSSLCIHQRVHTGEKPFKCDECGKAFSQSTSLCIHQRVHTKERNHLKISVI                       211 - 261
//

Text Mined References (19)

PMID Year Title
24667120 2014 Genome-wide association study identifies new disease loci for isolated clubfoot.
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21695231 2011 Exome sequencing identifies ZNF644 mutations in high myopia.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8634327 1996 A novel zinc finger gene preferentially expressed in the retina and the organ of Corti localizes to human chromosome 12q24.3.