Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.08
PubTator Score 7.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.400 9.3e-07
osteosarcoma 2.971 8.1e-07
atypical teratoid / rhabdoid tumor 1.800 4.8e-05
glioblastoma 1.700 1.4e-04
medulloblastoma 1.300 1.1e-02
medulloblastoma, large-cell 2.200 1.1e-04
primitive neuroectodermal tumor 1.600 1.7e-02
adult high grade glioma 1.700 1.1e-02
pilocytic astrocytoma 1.100 4.9e-02
psoriasis -1.100 1.3e-16
Pick disease 2.400 5.7e-06
cystic fibrosis and chronic rhinosinusit... 1.057 6.2e-04

Gene RIF (10)

PMID Text
25335771 Genetic association studies identify a novel variant in ZNF652 gene suggesting its role in prostate cancer.
21678463 De novo motif scanning of the ZNF652 binding sites identified a novel ZNF652 recognition motif that closely resembles the previously characterised in vitro binding site, being a 10 nucleotide core of that 13 nucleotide sequence.
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20852445 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20542020 variation in FGF5 and ZNF652 gene upstream regions with altered susceptibility to hypertension in Han Chinese
20542020 Observational study of gene-disease association. (HuGE Navigator)
20414254 Observational study of gene-disease association. (HuGE Navigator)
20204290 High levels of expression of both the androgen receptor and ZNF652 in clinically organ-defined prostate cancer are associated with a statistically increased risk of relapse
19430483 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18456661 CBFA2T3 interacts with ZNF652 to repress HEB expression, and in addition CBFA2T3 interacts with the HEB protein to inhibit its activator function.

AA Sequence

MSHTASSCQELVENCAVHVAGMAQEDSRRGQVPSSFYHGANQELDLSTKVYKRESGSPYSVLVDTKMSKP      1 - 70
HLHETEEQPYFRETRAVSDVHAVKEDRENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQ     71 - 140
SKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEKIVEKVSVTQRRTRRAASVAAATTSPTPRTT    141 - 210
RGRRKSVEPPKRKKRATKEPKAPVQKAKCEEKETLTCEKCPRVFNTRWYLEKHMNVTHRRMQICDKCGKK    211 - 280
FVLESELSLHQQTDCEKNIQCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVA    281 - 350
HTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGK    351 - 420
DFNMKQYFDEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEK    421 - 490
CFRVTSPVNVPPAVQIPLTTSPATPVPSVVNTATTPTPPINMNPVSTLPPRPIPHPFSHLHIHPHPHHPH    491 - 560
HLPIPPVPHLPPPPALFKSEPLNHRGQSEDNFLRHLAEKNSSAQHH                            561 - 606
//

Text Mined References (28)

PMID Year Title
25335771 2015 Fine-mapping the 2q37 and 17q11.2-q22 loci for novel genes and sequence variants associated with a genetic predisposition to prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22829776 2012 A genome-wide association meta-analysis of circulating sex hormone-binding globulin reveals multiple Loci implicated in sex steroid hormone regulation.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21678463 2011 Genome-wide mapping of ZNF652 promoter binding sites in breast cancer cells.
21602798 2011 Genome-wide association study of prostate cancer in men of African ancestry identifies a susceptibility locus at 17q21.
21045733 2011 Discovery and replication of novel blood pressure genetic loci in the Women's Genome Health Study.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20852445 2011 Common variants in or near FGF5, CYP17A1 and MTHFR genes are associated with blood pressure and hypertension in Chinese Hans.
20542020 2010 Confirmation of top polymorphisms in hypertension genome wide association study among Han Chinese.
20414254 2010 Recapitulation of two genomewide association studies on blood pressure and essential hypertension in the Korean population.
20204290 2010 Co-expression of the androgen receptor and the transcription factor ZNF652 is related to prostate cancer outcome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
18456661 2008 CBFA2T3-ZNF652 corepressor complex regulates transcription of the E-box gene HEB.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16966434 2006 ZNF652, a novel zinc finger protein, interacts with the putative breast tumor suppressor CBFA2T3 to repress transcription.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.