Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.21
PubTator Score 6.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.400 1.8e-06
psoriasis -1.300 2.4e-04
osteosarcoma -1.661 2.3e-06
glioblastoma 1.400 3.2e-07
group 3 medulloblastoma 1.300 4.5e-03
medulloblastoma, large-cell 1.400 3.0e-04
primitive neuroectodermal tumor 1.200 2.0e-03
juvenile dermatomyositis 1.064 4.7e-07
tuberculosis and treatment for 6 months 2.100 5.7e-07
non-small cell lung cancer 1.306 3.2e-08
pediatric high grade glioma 1.300 8.6e-06
pilocytic astrocytoma 1.100 6.9e-05
ovarian cancer 1.800 4.4e-04

Gene RIF (3)

PMID Text
24204263 ZASC1 as novel regulator of HIV-1 gene expression that functions through the DNA-dependent, RNA-independent recruitment of TAT/P-TEFb to the HIV-1 promoter.
24204263 ZASC1 interacts with HIV-1 Tat and cellular proteins CDK9/Cyclin T1 (P-TEFb) in a TAR-independent manner, suggesting that the Tat/P-TEFb complex in the transcriptional elongation site is promoted by ZASC1
20646234 ZASC1 copy number that increased from primary to recurrent tumor suggested the importance of ZASC1 in tumor progression. The increase of ZASC1 gene copy number in recurrent tumors was associated with the consumption of betel quid in patients.

AA Sequence

MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDLKYFDNKDDDSDTETSNDLPK      1 - 70
FADGIKARNRNQNYLVPSPVLRILDHTAFSTEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPI     71 - 140
AVEVHAISEDYDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANSSGLYKCELCE    141 - 210
FNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIEHAKLHEEDPYICKYCDYKTVIFENLSQHIA    211 - 280
DTHFSDHLYWCEQCDVQFSSSSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDK    281 - 350
YNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKIFPHVCDDCGKGFSSMLEYCK    351 - 420
HLNSHLSEGIYLCQYCEYSTGQIEDLKIHLDFKHSADLPHKCSDCLMRFGNERELISHLPVHETT         421 - 485
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24204263 2013 ZASC1 stimulates HIV-1 transcription elongation by recruiting P-TEFb and TAT to the LTR promoter.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20646234 2011 Increase of ZASC1 gene copy number in recurrent oral carcinoma.
20484494 2010 Cellular transcription factor ZASC1 regulates murine leukemia virus transcription.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17623809 2007 Functional persistence of exonized mammalian-wide interspersed repeat elements (MIRs).
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16182284 2005 Nuclear translocation of alphaN-catenin by the novel zinc finger transcriptional repressor ZASC1.
16051665 2005 Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522885 2003 Identification of ZASC1 encoding a Krüppel-like zinc finger protein as a novel target for 3q26 amplification in esophageal squamous cell carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.