Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.47
PubTator Score 0.25

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.9e-08
medulloblastoma, large-cell 6241 7.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.0


  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 7.0e-04
ovarian cancer -1.100 2.9e-08

AA Sequence

KHTGERPYGCSDCGKAFAHLSILVKHRRIHR                                           701 - 731

Text Mined References (6)

PMID Year Title