Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 3.4e-14
ovarian cancer 8520 6.4e-05
colon cancer 1478 6.3e-04
lung cancer 4740 7.6e-03

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.300 6.3e-04
lung adenocarcinoma 1.300 3.4e-14
lung cancer 1.300 7.6e-03
ovarian cancer 1.300 6.4e-05

Gene RIF (1)

AA Sequence

MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYF      1 - 70
IDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST           71 - 134
//

Text Mined References (18)

PMID Year Title