Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 3.7e-06
medulloblastoma, large-cell 1.500 4.0e-04
osteosarcoma -1.569 3.0e-06
sonic hedgehog group medulloblastoma 1.100 2.8e-05

AA Sequence

MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEE      1 - 70
SQREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAG     71 - 140
GGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP                 141 - 197
//

Text Mined References (7)

PMID Year Title