Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.65
PubTator Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.8e-29
osteosarcoma 7933 4.7e-06
Pick disease 1893 1.7e-04
invasive ductal carcinoma 2950 1.1e-02
Disease Target Count Z-score Confidence
Hemorrhagic thrombocythemia 8 3.518 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.655 4.7e-06
Pick disease 1.200 1.7e-04
invasive ductal carcinoma 1.100 1.1e-02
psoriasis -1.100 3.8e-29

Gene RIF (1)

PMID Text
21424380 Single nucleotide polymorphisms in ZNF577 gene is associated with breast cancer.

AA Sequence

MKNATIVMSVRREQGSSSGEGSLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYINLVSIGYRGTKPD      1 - 70
SLFKLEQGEPPGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKRDKTLTGVKYHRCVKPSS     71 - 140
PKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTERGEKPHGCGECGKTFMRKIQLTEHQRTHTG    141 - 210
EKPHECSECGKAFSRKSQLMVHQRTHTGEKPYRCSKCGKAFSRKCRLNRHQRSHTGEKLYGCSVCGKAFS    211 - 280
QKAYLTAHQRLHTGDKPYKCSDCGRTFYFKSDLTRHQRIHTGEKPYECSECEKAFRSKSKLIQHQRTHTG    281 - 350
ERPYSCRECGKAFAHMSVLIKHEKTHIRETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSS    351 - 420
GTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSVINYILYLTDIVSE         421 - 485
//

Text Mined References (6)

PMID Year Title
21424380 2011 Potential novel candidate polymorphisms identified in genome-wide association study for breast cancer susceptibility.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.