Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.65
PubTator Score 0.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.8e-29
osteosarcoma 7950 4.7e-06
Pick disease 1894 1.7e-04
invasive ductal carcinoma 2951 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.9

Expression

  Differential Expression (4)

Disease log2 FC p
invasive ductal carcinoma 1.100 1.1e-02
osteosarcoma 1.655 4.7e-06
Pick disease 1.200 1.7e-04
psoriasis -1.100 3.8e-29

Gene RIF (1)

AA Sequence

MKNATIVMSVRREQGSSSGEGSLSFEDVAVGFTREEWQFLDQSQKVLYKEVMLENYINLVSIGYRGTKPD      1 - 70
SLFKLEQGEPPGIAEGAAHSQICPGFVIQSRRYAGKDSDAFGGYGRSCLHIKRDKTLTGVKYHRCVKPSS     71 - 140
PKSQLNDLQKICAGGKPHECSVCGRAFSRKAQLIQHQRTERGEKPHGCGECGKTFMRKIQLTEHQRTHTG    141 - 210
EKPHECSECGKAFSRKSQLMVHQRTHTGEKPYRCSKCGKAFSRKCRLNRHQRSHTGEKLYGCSVCGKAFS    211 - 280
QKAYLTAHQRLHTGDKPYKCSDCGRTFYFKSDLTRHQRIHTGEKPYECSECEKAFRSKSKLIQHQRTHTG    281 - 350
ERPYSCRECGKAFAHMSVLIKHEKTHIRETAINSLTVEKPSSRSHTSLYMSELIQEQKTVNTVPIEMPSS    351 - 420
GTPPLLNKSERLVGRNVVIVEQPFPRNQAFVVNQEFEQRISLTNEVNVAPSVINYILYLTDIVSE         421 - 485
//

Text Mined References (6)

PMID Year Title