Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.42
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
osteosarcoma -1.489 1.1e-03
adrenocortical carcinoma 1.449 3.3e-04
intraductal papillary-mucinous adenoma (... 1.800 2.1e-05
intraductal papillary-mucinous carcinoma... 1.400 7.5e-05
intraductal papillary-mucinous neoplasm ... 1.900 2.6e-04
spina bifida -2.399 3.5e-02
gastric carcinoma -1.500 1.7e-02
ulcerative colitis -1.500 6.9e-06

Gene RIF (1)

PMID Text
20356463 ZNF424 protein may act as a transcriptional repressor that suppresses NFAT and p21 pathway to mediate cellular functions.

AA Sequence

MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNLASVDDGTQFKANGSVSLQDMYGQEKSKEQT      1 - 70
IPNFTGNNSCAYTLEKNCEGYGTEDHHKNLRNHMVDRFCTHNEGNQYGEAIHQMPDLTLHKKVSAGEKPY     71 - 140
ECTKCRTVFTHLSSLKRHVKSHCGRKAPPGEECKQACICPSHLHSHGRTDTEEKPYKCQACGQTFQHPRY    141 - 210
LSHHVKTHTAEKTYKCEQCRMAFNGFASFTRHVRTHTKDRPYKCQECGRAFIYPSTFQRHMTTHTGEKPY    211 - 280
KCQHCGKAFTYPQAFQRHEKTHTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKLYKCEHCGKAFTSSRS    281 - 350
FQGHLRTHTGEKPYECKQCGKAFTWSSTFREHVRIHTQEQLYKCEQCGKAFTSSRSFRGHLRTHTGEKPY    351 - 420
ECKQCGKTFTWSSTFREHVRIHTQEQLHKCEHCGKAFTSSRAFQGHLRMHTGEKPYECKQCGKTFTWSST    421 - 490
LHNHVRMHTGEKPHKCKQCGMSFKWHSSFRNHLRMHTGQKSHECQSYSKAFSCQVILSKTSESTH         491 - 555
//

Text Mined References (6)

PMID Year Title
20356463 2010 ZNF424, a novel human KRAB/C2H2 zinc finger protein, suppresses NFAT and p21 pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1946370 1991 Characterization and mapping of human genes encoding zinc finger proteins.
1505991 1992 Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes.