Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.0e-11
osteosarcoma 7950 5.9e-06
primitive neuroectodermal tumor 3035 6.7e-04
breast carcinoma 1638 2.5e-02
group 4 medulloblastoma 1855 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma -1.100 2.5e-02
group 4 medulloblastoma 1.100 2.8e-02
osteosarcoma 2.549 5.9e-06
primitive neuroectodermal tumor 1.100 6.7e-04
psoriasis -1.700 3.0e-11

AA Sequence

MAQGSVSFNDVTVDFTQEEWQHLDHAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLERGEEPWTSFAG      1 - 70
HTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYEKTFTLGKNPVNSKNLPPEYDTHGRI     71 - 140
LKNVSELIISNLNPARKRLSEYNGYGKSLLSTKQETTHPEVKSHNQSARAFSHNEVLMQYQKTETPAQSF    141 - 210
GYNDCEKSFLQRGGLITHSRPYKGENPSVYNKKRRATNIEKKHTCNECGKSFCRKSVLILHQGIHSEEKP    211 - 280
YQCHQCGNAFRRKSYLIDHQRTHTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECLQCRNAFRLKS    281 - 350
HLIRHQRTHTGEKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKP    351 - 420
YICNECGKSFSQKTTLALHEKTHNEEKPYICSECGKSFRQKTTLVAHQRTHTGEKSYECPHCGKAFRMKS    421 - 490
YLIDHHRTHTGEKPYECNECGKSFSQKTNLNLHQRIHTGEKPYVCNECGKSFRQKATLTVHQKIHTGQKS    491 - 560
YECPQCGKAFSRKSYLIHHQRTHTGEKPYKCSECGKCFRQKTNLIVHQRTHTGEKPYVCNECGKSFSYKR    561 - 630
NLIVHQRTHKGENIEMQ                                                         631 - 647
//

Text Mined References (8)

PMID Year Title