Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20

Knowledge Summary


No data available


  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.500 6.3e-07
glioblastoma multiforme 1.200 1.3e-13
osteosarcoma 2.451 3.1e-05
sonic hedgehog group medulloblastoma 1.800 2.7e-05
atypical teratoid / rhabdoid tumor 1.100 6.5e-03
medulloblastoma, large-cell 1.700 1.9e-04
primitive neuroectodermal tumor 1.300 3.4e-04
adrenocortical carcinoma 1.009 9.4e-03
lung cancer 1.100 4.0e-03
ovarian cancer 1.200 5.1e-09

AA Sequence

IQHQRVHTGERPYECSECGKSFSRKSNLIRHRRVHTEERP                                  631 - 670

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
2288909 1990 Multiple genes encoding zinc finger domains are expressed in human T cells.