Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.800 1.4e-03
Astrocytoma, Pilocytic 1.200 1.8e-04
atypical teratoid / rhabdoid tumor 2.300 2.5e-07
ependymoma 1.400 5.9e-09
glioblastoma 1.500 4.2e-06
group 3 medulloblastoma 1.900 4.1e-04
lung cancer -1.100 5.0e-03
medulloblastoma, large-cell 2.600 7.6e-06
osteosarcoma -1.786 6.8e-05
ovarian cancer 2.200 3.0e-08
primitive neuroectodermal tumor 1.400 1.7e-03

AA Sequence

MNLTEGRVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGSWHGAEDEEAPSQQGFSVGVSE      1 - 70
VTASKPCLSSQKVHPSETCGPPLKDILCLVEHNGIHPEQHIYICEAELFQHPKQQIGENLSRGDDWIPSF     71 - 140
GKNHRVHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTEDREAFQTGQNDYKCSECGKTFTCSY    141 - 210
SFVEHQKIHTGERSYECNKCGKFFKYSANFMKHQTVHTSERTYECRECGKSFMYNYRLMRHKRVHTGERP    211 - 280
YECNTCGKFFRYSSTFVRHQRVHTGERPYECRECGKFFMDSSTLIKHQRVHTGERPYKCNDCGKFFRYIS    281 - 350
TLIRHQRIHTGERPYECSVCGELFRYNSSLVKHWRNHTGERPYKCSECGKSFRYHCRLIRHQRVHTGERP    351 - 420
YECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQKIHSGERPYECSECQKAFIRKS    421 - 490
HLVHHQKIHSEERLVCSMNVGNSLAKTPTSLNIRDFTMEKVYH                               491 - 533
//

Text Mined References (6)

PMID Year Title