Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.30
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.600 1.5e-02
posterior fossa group A ependymoma -2.100 2.7e-05
oligodendroglioma -1.700 4.6e-08
glioblastoma -3.300 1.1e-04
group 4 medulloblastoma 2.400 1.9e-05
atypical teratoid / rhabdoid tumor -2.200 2.0e-02
pediatric high grade glioma -3.100 2.4e-06
pilocytic astrocytoma -3.300 3.3e-08
subependymal giant cell astrocytoma -3.963 3.3e-03
lung carcinoma 1.500 4.1e-08
ovarian cancer -1.500 1.8e-07
pituitary cancer -4.500 5.3e-13
psoriasis -1.600 3.7e-59

Gene RIF (2)

PMID Text
18187620 Knockdown of zinc finger protein 536 (ZNF536) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17065439 ZFP536 promotes the late phase of oligodendrocyte differentiation.

AA Sequence

MEEASLCLGVSSAEPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKPPASLEEKAHV      1 - 70
PMSGQPMGSQMALLANQLGREVDTSLNGRVDLQQFLNGQNLGIMSQMSDIEDDARKNRKYPCPLCGKRFR     71 - 140
FNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTHKLGNLGKGRGRVREENRLLHELEERAILRD    141 - 210
KQLKGSLLQPRPDLKPPPHAQQAPLAACTLALQANHSVPDVAHPVPSPKPASVQEDAVAPAAGFRCTFCK    211 - 280
GKFKKREELDRHIRILHKPYKCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVC    281 - 350
GQVFSQAWFLKGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ    351 - 420
EAHANLYSRYLSCLQSGFMTPDKAGLSEPSQLYGKGELPMKEKEALGKLLSPISSMAHGVPEGDKHSLLG    421 - 490
CLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSKEHPLQRNHEDTLANAGVLFD    491 - 560
KEKREYVLVGADGSKQKMPADLVHSTKVGSQRDLPSKLDPLESSRDFLSHGLNQTLEYNLQGPGNMKEKP    561 - 630
TECPDCGRVFRTYHQVVVHSRVHKRDRKGEEDGLHVGLDERRGSGSDQESQSVSRSTTPGSSNVTEESGV    631 - 700
GGGLSQTGSAQEDSPHPSSPSSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHL    701 - 770
RIHTGEKPYKCPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQDHKDEMSSKASLFIRPDILRG    771 - 840
AFKGLPGIDFRGGPASQQWTSGVLSSGDHSGQATGMSSEVPSDALKGTDLPSKSTHFSEIGRAYQSIVSN    841 - 910
GVNFQGSLQAFMDSFVLSSLKKEKDMKDKALADPPSMKVHGVDGGEEKPSGKSSQRKSEKSQYEPLDLSV    911 - 980
RPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHLQANHLGKAKRKDNTIGVTVNCKDQAREASK    981 - 1050
MALLPSLQSNKDLGLSNMISSLDSASEKMAQGQLKETLGEQKSGAWTGHVDPAFCNFPSDFYKQFGVYPG   1051 - 1120
MVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMM   1121 - 1190
TKPLSALSKDSSSDGGDSLQPTGTSQPVQGLVSPLSQAPEKQWHSQGLLQAQDPLAGLPKPERGPQSLDK   1191 - 1260
PMNMLSVLRAYSSDGLAAFNGLASSTANSGCIKRPDLCGK                                 1261 - 1300
//

Text Mined References (15)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24939585 2015 Genome-wide association analysis demonstrates the highly polygenic character of age-related hearing impairment.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19398580 2009 ZNF536, a novel zinc finger protein specifically expressed in the brain, negatively regulates neuron differentiation by repressing retinoic acid-induced gene transcription.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17065439 2006 Functional genomic analysis of oligodendrocyte differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14621294 2003 Identification of the DNA binding specificity of the human ZNF219 protein and its function as a transcriptional repressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.