Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.30
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.900 6.6e-04
astrocytic glioma -2.100 6.9e-03
Astrocytoma, Pilocytic -2.500 8.1e-07
atypical teratoid / rhabdoid tumor -2.200 2.0e-02
ependymoma -1.900 3.4e-02
glioblastoma -1.900 6.0e-05
group 3 medulloblastoma 2.000 3.5e-03
lung carcinoma 1.500 4.1e-08
oligodendroglioma -1.500 3.1e-02
ovarian cancer -1.500 1.8e-07
pituitary cancer -3.800 1.1e-16
psoriasis -1.600 3.7e-59
subependymal giant cell astrocytoma -3.963 3.3e-03

Gene RIF (2)

AA Sequence

MEEASLCLGVSSAEPEAEPHLSGPVLNGQYAMSQKLHQITSQLSHAFPELHPRPNPEEKPPASLEEKAHV      1 - 70
PMSGQPMGSQMALLANQLGREVDTSLNGRVDLQQFLNGQNLGIMSQMSDIEDDARKNRKYPCPLCGKRFR     71 - 140
FNSILSLHMRTHTGEKPFKCPYCDHRAAQKGNLKIHLRTHKLGNLGKGRGRVREENRLLHELEERAILRD    141 - 210
KQLKGSLLQPRPDLKPPPHAQQAPLAACTLALQANHSVPDVAHPVPSPKPASVQEDAVAPAAGFRCTFCK    211 - 280
GKFKKREELDRHIRILHKPYKCTLCDFAASQEEELISHVEKAHITAESAQGQGPNGGGEQSANEFRCEVC    281 - 350
GQVFSQAWFLKGHMRKHKDSFEHCCQICGRRFKEPWFLKNHMKVHLNKLSVKNKSPSDPEVPVPMGGMSQ    351 - 420
EAHANLYSRYLSCLQSGFMTPDKAGLSEPSQLYGKGELPMKEKEALGKLLSPISSMAHGVPEGDKHSLLG    421 - 490
CLNLVPPLKSSCIERLQAAAKAAEMDPVNSYQAWQLMARGMAMEHGFLSKEHPLQRNHEDTLANAGVLFD    491 - 560
KEKREYVLVGADGSKQKMPADLVHSTKVGSQRDLPSKLDPLESSRDFLSHGLNQTLEYNLQGPGNMKEKP    561 - 630
TECPDCGRVFRTYHQVVVHSRVHKRDRKGEEDGLHVGLDERRGSGSDQESQSVSRSTTPGSSNVTEESGV    631 - 700
GGGLSQTGSAQEDSPHPSSPSSSDIGEEAGRSAGVQQPALLRDRSLGSAMKDCPYCGKTFRTSHHLKVHL    701 - 770
RIHTGEKPYKCPHCDYAGTQSASLKYHLERHHRERQNGAGPLSGQPPNQDHKDEMSSKASLFIRPDILRG    771 - 840
AFKGLPGIDFRGGPASQQWTSGVLSSGDHSGQATGMSSEVPSDALKGTDLPSKSTHFSEIGRAYQSIVSN    841 - 910
GVNFQGSLQAFMDSFVLSSLKKEKDMKDKALADPPSMKVHGVDGGEEKPSGKSSQRKSEKSQYEPLDLSV    911 - 980
RPDAASLPGSSVTVQDSIAWHGCLFCAFTTSSMELMALHLQANHLGKAKRKDNTIGVTVNCKDQAREASK    981 - 1050
MALLPSLQSNKDLGLSNMISSLDSASEKMAQGQLKETLGEQKSGAWTGHVDPAFCNFPSDFYKQFGVYPG   1051 - 1120
MVGSGASSSCPNKEPDGKAHSEEDVPILIPETTSKNTTDDLSDIASSEDMDSSKGENNDEEDVETEPEMM   1121 - 1190
TKPLSALSKDSSSDGGDSLQPTGTSQPVQGLVSPLSQAPEKQWHSQGLLQAQDPLAGLPKPERGPQSLDK   1191 - 1260
PMNMLSVLRAYSSDGLAAFNGLASSTANSGCIKRPDLCGK                                 1261 - 1300
//

Text Mined References (17)

PMID Year Title