Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 1.300 8.4e-03
adult high grade glioma -1.400 8.9e-03
Astrocytoma, Pilocytic -1.400 1.9e-03
atypical teratoid / rhabdoid tumor -1.900 1.8e-05
ependymoma -1.300 9.2e-05
glioblastoma -1.400 4.4e-02
group 3 medulloblastoma -1.100 1.5e-02
juvenile dermatomyositis 1.098 1.0e-10
medulloblastoma, large-cell -1.600 2.1e-04
osteosarcoma -1.032 8.2e-03
ovarian cancer -1.600 5.9e-05
psoriasis -1.800 1.1e-04
subependymal giant cell astrocytoma -1.893 1.8e-02

AA Sequence

MANSSFIGDHVHGAPHAVMPEVEFPDQFFTVLTMDHELVTLRDVVINFSQEEWEYLDSAQRNLYWDVMME      1 - 70
NYSNLLSLDLESRNETKHLSVGKDIIQNTGSQWEVMESSKLCGLEGSIFRNDWQSKSKIDLQGPEVGYFS     71 - 140
QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVFSCDLEFDEYQKIHTGGKNYECNQCWKTFGI    141 - 210
DNSSMLQLNIHTGVKPCKYMEYGNTCSFYKDFNVYQKIHNEKFYKCKEYRRTFERVGKVTPLQRVHDGEK    211 - 280
HFECSFCGKSFRVHAQLTRHQKIHTDEKTYKCMECGKDFRFHSQLTEHQRIHTGEKPYKCMHCEKVFRIS    281 - 350
SQLIEHQRIHTGEKPYACKECGKAFGVCRELARHQRIHTGKKPYECKACGKVFRNSSSLTRHQRIHTGEK    351 - 420
PYKCKECEKAFGVGSELTRHERIHSGQKPYECKECGKFFRLTSALIQHQRIHSGEKPYECKVCGKAFRHS    421 - 490
SALTEHQRIHTGEKPYECKACGKAFRHSSSFTKHQRIHTDDKPYECKECGNSFSVVGHLTCQPKIYTGEK    491 - 560
SFD                                                                       561 - 563
//

Text Mined References (9)

PMID Year Title