Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 2.6e-05
tuberculosis 2010 1.2e-04
primary pancreatic ductal adenocarcinoma 1109 5.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Large cell carcinoma 7 3.811 1.9
Lung large cell carcinoma 6 3.772 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
ovarian cancer -1.500 2.6e-05
primary pancreatic ductal adenocarcinoma 1.168 5.1e-03
tuberculosis 1.100 1.2e-04

Gene RIF (3)

AA Sequence

MSSRLGAVPATSGPTTFKQQRSTRIVGAKNSRTQCSIKDNSFQYTIPHDDSLSGSSSASSCEPVSDFPAS      1 - 70
FRKSTYWMKMRRIKPAATSHVEGSGGVSAKGKRKPRQEEDEDYREFPQKKHKLYGRKQRPKTQPNPKSQA     71 - 140
RRIRKEPPVYAAGSLEEQWYLEIVDKGSVSCPTCQAVGRKTIEGLKKHMENCKQEMFTCHHCGKQLRSLA    141 - 210
GMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCMRESCSSSFTSIMGYLYHVRKCGKGAA    211 - 280
ELEKMTLKCHHCGKPYRSKAGLAYHLRSEHGPISFFPESGQPECLKEMNLESKSGGRVQRRSAKIAVYHL    281 - 350
QELASAELAKEWPKRKVLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIKKYHRIQCPNQGCEAVYSSV    351 - 420
SGLKAHLGSCTLGNFVAGKYKCLLCQKEFVSESGVKYHINSVHAEDWFVVNPTTTKSFEKLMKIKQRQQE    421 - 490
EEKRRQQHRSRRSLRRRQQPGIELPETELSLRVGKDQRRNNEELVVSASCKEPEQEPVPAQFQKVKPPKT    491 - 560
NHKRGRK                                                                   561 - 567
//

Text Mined References (15)

PMID Year Title