Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.9e-09
psoriasis 6694 8.9e-06
head and neck cancer 271 3.5e-02
primitive neuroectodermal tumor 3035 3.7e-02
ependymoma 4679 3.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.300 3.9e-02
head and neck cancer 1.200 3.5e-02
osteosarcoma -2.502 1.9e-09
primitive neuroectodermal tumor 1.300 3.7e-02
psoriasis -3.000 8.9e-06

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDAAQRNLYRDVMLENYRNLIFLGIVVSKPNLITCLEQGKKPLTMKRHEM      1 - 70
IAKPPVMYSHFAQDLWSEQSIKDSFQKVILRRYEKCRHDNLQLKKGCESVDECPVHKRGYNGLKQCLATT     71 - 140
QRKIFQCDEYVKFLHKFSNSNKHKIRDTGKKSFKCIEYGKTFNQSSTRTTYKKIDAGEKRYKCEECGKAY    141 - 210
KQSSHLTTHKKIHTGEKPYKCEECGKAYKQSCNLTTHKIIHTGEKPYRCRECGKAFNHPATLFSHKKIHT    211 - 280
GEKPYKCDKCGKAFISSSTLTKHEIIHTGEKPYKCEECGKAFNRSSNLTKHKRIHTGDVPYKCDECGKTF    281 - 350
TWYSSLSKHKRAHTGEKPYKCEECGKAFTAFSTLTEHKIIHTGEKPYKCEECGKAFNWSSALNKHKKIHI    351 - 420
RQKPCIVKNVENLLNVPQPLISIR                                                  421 - 444
//

Text Mined References (6)

PMID Year Title