Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
head and neck cancer 271 8.2e-06
Pick disease 1894 7.5e-05
psoriasis 6694 9.6e-05
osteosarcoma 7950 1.3e-03
oligodendroglioma 2850 2.3e-03
ependymoma 4679 1.1e-02
progressive supranuclear palsy 676 1.4e-02
Alzheimer's disease 658 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (8)

Disease log2 FC p
Alzheimer's disease 1.300 1.6e-02
ependymoma 1.100 1.1e-02
head and neck cancer -1.100 8.2e-06
oligodendroglioma 1.100 2.3e-03
osteosarcoma 1.061 1.3e-03
Pick disease 1.200 7.5e-05
progressive supranuclear palsy 1.600 1.4e-02
psoriasis 1.600 9.6e-05

AA Sequence

MATVPGLQPLPTLEQDLEQEEILIVKVEEDFCLEEEPSVETEDPSPETFRQLFRLFCYQEVAGPREALSR      1 - 70
LWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEEAVVLVEGLQRKPRKHRQRGS     71 - 140
ELLSDDEVPLGIGGQFLKHQAEAQPEDLSLEEEARFSSQQPPAQLSHRPQRGPLLWPERGPPAPRHQEMA    141 - 210
SASPFLSAWSQVPVNLEDVAVYLSGEEPRCMDPAQRDAPLENEGPGIQLEDGGDGREDAPLRMEWYRVLS    211 - 280
ARCQGPGHPLPGQRPAPVRGLVRPDQPRGGPPPGRRASHGADKPYTCPECGKGFSKTSHLTKHQRTHTGE    281 - 350
RPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNN    351 - 420
SSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHMGAGSLPTLQPVAPGGPGAKA              421 - 480
//

Text Mined References (10)

PMID Year Title