Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.53
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MAKRPGPPGSREMGLLTFRDIAIEFSLEEWQCLDCAQRNLYRDVMLENYRNLVSLGIAVSKPDLITCLEQ      1 - 70
NKESQNIKRNEMVAKHPVTRSHFTQDLQPEQGIKDSLQKVIPRTYGKCGHEKLQFKKCCKSVGEYEVHKG     71 - 140
GYSEVNQCLSTTQNKIFQTHKYVKVFGKFSNSNRDKTRYTGNKHFKCNKYGKSFCMLSHLNQHQVIHTRE    141 - 210
KSYKCKECGKSFNCSSNHTTHKIIHTGEKPYRCEECGKAFSWSANLTRHKRTHTGEKPYTCEECGQAFRR    211 - 280
SSALTNHKRIHTGERPYKCEECGKAFSVSSTLTDHKRIHTGEKPCRCEECGKAFSWSSNLTRHKRIHTRE    281 - 350
KPYACEECGQAFSLSSNLMRHRRIHTGEKPYTCEECGQDFRRSSALTIHKRIHTGERPYKCEECGKVFSL    351 - 420
SSTLTDHKRIHTGERPYKCEECGKAFSLSSTLTDHKRIHTGERPYTCEECGKAFNCSSTLMQHKRIHTGE    421 - 490
KPYKCEECEQAFKWHSSLAKHKIIHTGEKPYKCE                                        491 - 524
//

Text Mined References (1)

PMID Year Title