Property Summary

NCBI Gene PubMed Count 1
PubMed Score 2.53
PubTator Score 2.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

AA Sequence

KPYKCEECEQAFKWHSSLAKHKIIHTGEKPYKCE                                        491 - 524

Text Mined References (1)

PMID Year Title
11410164 2001 Molecular cloning and preliminary functional analysis of two novel human KRAB zinc finger proteins, HKr18 and HKr19.