Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
ductal carcinoma in situ 1.100 2.2e-03
esophageal adenocarcinoma 1.300 1.8e-02
group 4 medulloblastoma 1.300 3.6e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.7e-02
osteosarcoma -1.227 3.7e-03
pancreatic cancer 1.100 8.2e-03
pancreatic carcinoma 1.100 8.2e-03
psoriasis -1.300 1.9e-03

Gene RIF (1)

AA Sequence

MALPQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMLKTLSSTGQGNTEVIH      1 - 70
TGTLHRQASHHIGEFCFHEIEKDIHGFEFQWKEDETNGHAAPMTEIKELAGSTGQHDQRHAGNKRIKDQL     71 - 140
GSSFHLHLPEPHIFQSEGKIGNQVEKSINNASSVSTSQRICCRPKTHISNKYGNNSLHSSLLTQKWEVHM    141 - 210
REKSFECIQSFKSFNCSSLLKKHQIIHLEEKQCKCDVCGKVFNQKRYLACHRRCHTGEKPYKCNECGKTF    211 - 280
GHNSSLFIHKALHTGEKPYECEECDKVFSRKSHLERHKRIHTGEKPYKCKVCDEAFAYNSYLAKHTILHT    281 - 350
GEKPYTCNECGKVFNRLSTLARHHRLHTGEKPYKCEECDKVFSRKSHLERHRRIHSGEKPYKCEECCKVF    351 - 420
SRKSNLERHRRIHTGEKPYKCKVCDKAFQRDSHLAQHQRVHTGEKPYKCNECGKTFGQTSSLIIHRRLHT    421 - 490
GEKPYKCNECGKTFSQMSSLVYHHRLHSGEKP                                          491 - 522
//

Text Mined References (6)

PMID Year Title