Property Summary

NCBI Gene PubMed Count 6
PubMed Score 8.93
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 2.900 6.2e-09
osteosarcoma -1.454 2.2e-03
tuberculosis 1.500 4.6e-05
lung cancer -1.100 1.4e-02
group 3 medulloblastoma -1.100 2.9e-03
spina bifida 1.039 3.7e-02
invasive ductal carcinoma 1.300 2.8e-03

Gene RIF (2)

PMID Text
22700861 ZNF467 gene DNA methylation is importants in the pathogenesis of idiopathic pulmonary fibrosis.
17848547 These results identify EZI as a novel cargo protein for importin-7 and demonstrate a nucleocytoplasmic shuttling mechanism that is mediated by importin-7-dependent nuclear localization and CRM1-independent nuclear export.

AA Sequence

MRETLEALSSLGFSVGQPEMAPQSEPREGSHNAQEQMSSSREERALGVCSGHEAPTPEEGAHTEQAEAPC      1 - 70
RGQACSAQKAQPVGTCPGEEWMIRKVKVEDEDQEAEEEVEWPQHLSLLPSPFPAPDLGHLAAAYKLEPGA     71 - 140
PGALSGLALSGWGPMPEKPYGCGECERRFRDQLTLRLHQRLHRGEGPCACPDCGRSFTQRAHMLLHQRSH    141 - 210
RGERPFPCSECDKRFSKKAHLTRHLRTHTGERPYPCAECGKRFSQKIHLGSHQKTHTGERPFPCTECEKR    211 - 280
FRKKTHLIRHQRIHTGERPYQCAQCARSFTHKQHLVRHQRVHQTAGPARPSPDSSASPHSTAPSPTPSFP    281 - 350
GPKPFACSDCGLSFGWKKNLATHQCLHRSEGRPFGCDECALGATVDAPAAKPLASAPGGPGCGPGSDPVV    351 - 420
PQRAPSGERSFFCPDCGRGFSHGQHLARHPRVHTGERPFACTQCDRRFGSRPNLVAHSRAHSGARPFACA    421 - 490
QCGRRFSRKSHLGRHQAVHTGSRPHACAVCARSFSSKTNLVRHQAIHTGSRPFSCPQCGKSFSRKTHLVR    491 - 560
HQLIHGEAAHAAPDAALAAPAWSAPPEVAPPPLFF                                       561 - 595
//

Text Mined References (6)

PMID Year Title
22700861 2012 Altered DNA methylation profile in idiopathic pulmonary fibrosis.
21123171 2011 Zinc finger protein 467 is a novel regulator of osteoblast and adipocyte commitment.
17848547 2007 Nucleocytoplasmic shuttling of the zinc finger protein EZI Is mediated by importin-7-dependent nuclear import and CRM1-independent export mechanisms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426389 2002 A novel nuclear zinc finger protein EZI enhances nuclear retention and transactivation of STAT3.