Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.78
PubTator Score 0.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.060 2.2e-07
adult high grade glioma 1.500 3.0e-03
aldosterone-producing adenoma -1.796 1.8e-02
astrocytic glioma 1.400 1.1e-03
ependymoma 1.600 6.7e-03
gastric cancer 1.100 7.0e-03
glioblastoma 1.300 1.2e-05
group 3 medulloblastoma 1.700 1.0e-02
medulloblastoma, large-cell 1.900 1.4e-03
non primary Sjogren syndrome sicca -1.200 2.1e-02
oligodendroglioma 1.400 8.9e-03
osteosarcoma 1.449 7.7e-05
Pick disease 1.300 1.7e-04
primitive neuroectodermal tumor 2.000 8.9e-05
sarcoidosis -1.100 5.6e-03
spina bifida -2.701 2.8e-02

AA Sequence

MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLYMNVMLENYKN      1 - 70
LVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQDIKDSFQQVILRRYGKCEHE     71 - 140
NLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDKYVKVFHKFLNANRHKTRHTGKKPFKCKKCG    141 - 210
KSFCMLLHLSQHKRIHIRENSYQCEECGKAFKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKI    211 - 280
IHTGEKPYRCEECGKAFNRSSHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECD    281 - 350
KAFNRFSYLTKHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM    351 - 420
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTGEKPYKCEECG    421 - 490
KAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPYNCEECDNTFNQSSNLIKQNN    491 - 560
SYWRETLQMSRMWESL                                                          561 - 576
//

Text Mined References (8)

PMID Year Title