Property Summary

NCBI Gene PubMed Count 25
PubMed Score 40.76
PubTator Score 21.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.700 1.4e-05
ependymoma 2.400 3.2e-02
oligodendroglioma 1.700 2.8e-02
psoriasis -1.900 9.0e-07
group 4 medulloblastoma 2.300 2.1e-06
cystic fibrosis -4.324 6.0e-07
Atopic dermatitis -1.300 8.4e-03
intraductal papillary-mucinous adenoma (... -3.700 3.9e-05
intraductal papillary-mucinous carcinoma... -4.000 3.2e-05
intraductal papillary-mucinous neoplasm ... -3.600 1.8e-03
lung adenocarcinoma -1.051 7.7e-06
breast carcinoma -1.100 6.3e-16
ductal carcinoma in situ -1.400 6.2e-03
invasive ductal carcinoma -2.100 7.0e-03
ovarian cancer 1.800 8.2e-04

Gene RIF (11)

PMID Text
26788497 two multi-zinc finger transcription cofactors named ZNF423 and ZNF521 have been characterised as potent inhibitors of EBF1 and are emerging as potentially relevant contributors to the development of B-cell leukaemias
25219468 OAZ gene expression was highly enriched in mesenchymal stem cells (MSCs) compared with peripheral blood leukocytes and was increased in patients with systemic lupus erythematosus (SLE) compared with control subjects.
24081948 ZNF423 is a target for epigenetic deregulation and BMP2-dependent pathways in childhood B precursor acute lymphoblastic leukemia. Aberrant ZNF423 inhibits EBF-1 target genes, leads to a B cell maturation arrest in vivo and is associated with poor outcome of ETV6-RUNX1-negative acute lymphoblastic leukemia.
24081948 ZNF423 expression is associated with poor outcome of ETV6-RUNX1-negative B precursor acute lymphoblastic leukemia patients.
23878065 These findings suggest that expression of UBR5-ZNF423 protein might contribute to the transformation of a subset of Nasopharyngeal carcinoma
22863007 Study identifies by whole-exome resequencing, mutations of MRE11, ZNF423, and CEP164 as causing Nephronophthisis-related ciliopathies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20359360 Elevated expression of OAZ transcripts in systemic lupus erythematosus PBLs were strongly correlated with disease activity.
20017333 The expression level of OAZ mRNA in the bone marrow and peripheral blood of SLE patients was significantly increased than those observed in normal controls.
19345331 Low ZNF423 expression is associated with neuroblastoma.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MHKKRVEEGEASDFSLAWDSSVTAAGGLEGEPECDQKTSRALEDRNSVTSQEERNEDDEDMEDESIYTCD      1 - 70
HCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLGLGEEEGGTGLPYPC     71 - 140
QFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIKLHTGDKKYHCHECEAAFSRSDHLK    141 - 210
IHLKTHSSSKPFKCTVCKRGFSSTSSLQSHMQAHKKNKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEK    211 - 280
HVLTRHPQLSEKADLQCIHCPEVFVDENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDS    281 - 350
SNHSVSPDPVLGSVASMSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWTKVVYSCPYCSKRDFN    351 - 420
SLAVLEIHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKNHAYPVMQFGNISAFHCNYCPEMFA    421 - 490
DINSLQEHIRVSHCGPNANPSDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSAKLESPVVQPTQSFM    491 - 560
EVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNG    561 - 630
EYPCNQCDLKFSNFESFQTHLKLHLELLLRKQACPQCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQ    631 - 700
FSSVDDLQKHLLDMHTFVLYHCTLCQEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVK    701 - 770
HSHLGNPAKAHKCIFCGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENG    771 - 840
TANGVPPMATKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHRLRDHN    841 - 910
IRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICGERFPSLLTLTEHKVT    911 - 980
HSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVCMQTVTSTLELKIHGTFHMQKLAGSS    981 - 1050
AASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVNGLPYGLCAGCMARSANGQVGGLAPPEPADRPCAGL   1051 - 1120
RCPECSVKFESAEDLESHMQVDHRDLTPETSGPRKGTQTSPVPRKKTYQCIKCQMTFENEREIQIHVANH   1121 - 1190
MIEEGINHECKLCNQMFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYD   1191 - 1260
CSQCPQKFFFQTELQNHTMSQHAQ                                                 1261 - 1284
//

Text Mined References (26)

PMID Year Title
26788497 2015 ZNF423 and ZNF521: EBF1 Antagonists of Potential Relevance in B-Lymphoid Malignancies.
25219468 2014 Restored immunosuppressive effect of mesenchymal stem cells on B cells after olfactory 1/early B cell factor-associated zinc-finger protein down-regulation in patients with systemic lupus erythematosus.
24081948 2013 Aberrant ZNF423 impedes B cell differentiation and is linked to adverse outcome of ETV6-RUNX1 negative B precursor acute lymphoblastic leukemia.
23878065 2013 Identification of a recurrent transforming UBR5-ZNF423 fusion gene in EBV-associated nasopharyngeal carcinoma.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22863007 2012 Exome capture reveals ZNF423 and CEP164 mutations, linking renal ciliopathies to DNA damage response signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20359360 2010 Olf1/EBF associated zinc finger protein interfered with antinuclear antibody production in patients with systemic lupus erythematosus.
20017333 2009 [Gene expression of OAZ pathway in the patients of systemic lupus erythematosus].
19345331 2009 ZNF423 is critically required for retinoic acid-induced differentiation and is a marker of neuroblastoma outcome.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623329 2003 Poly(ADP-ribose) polymerase 1 interacts with OAZ and regulates BMP-target genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12136093 2002 Bone morphogenetic protein-4-induced activation of Xretpos is mediated by Smads and Olf-1/EBF associated zinc finger (OAZ).
10660046 2000 OAZ uses distinct DNA- and protein-binding zinc fingers in separate BMP-Smad and Olf signaling pathways.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9151733 1997 Cloning and functional characterization of Roaz, a zinc finger protein that interacts with O/E-1 to regulate gene expression: implications for olfactory neuronal development.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.