Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.400 4.7e-02
adrenocortical carcinoma 2.227 9.7e-05
Astrocytoma, Pilocytic -1.400 5.2e-03
ependymoma 1.900 2.0e-02
interstitial cystitis -1.200 5.4e-03
medulloblastoma, large-cell -3.700 4.2e-07
mucosa-associated lymphoid tissue lympho... -1.016 1.5e-02
ovarian cancer -1.800 6.3e-07

Gene RIF (1)

AA Sequence

MARVPLTFSDVAIDFSQEEWEYLNSDQRDLYRDVMLENYTNLVSLDFNFTTESNKLSSEKRNYEVNAYHQ      1 - 70
ETWKRNKTFNLMRFIFRTDPQYTIEFGRQQRPKVGCFSQMIFKKHKSLPLHKRNNTREKSYECKEYKKGF     71 - 140
RKYLHLTEHLRDHTGVIPYECNECGKAFVVFQHFIRHRKIHTDLKPYECNGCEKAFRFYSQLIQHQIIHT    141 - 210
GMKPYECKQCGKAFRRHSHLTEHQKIHVGLKPFECKECGETFRLYRHMCLHQKIHHGVKPYKCKECGKAF    211 - 280
GHRSSLYQHKKIHSGEKPYKCEQCEKAFVRSYLLVEHQRSHTGEKPHECMECGKAFGKGSSLLKHKRIHS    281 - 350
SEKLYDCKDCGKAFCRGSQLTQHQRIHTGEKPHECKECGKTFKLHSYLIQHQIIHTDLKPYECKQCGKAF    351 - 420
SRVGDLKTHQSIHAGEKPYECKECGKTFRLNSQLIYHQTIHTGLKPYVCKECKKAFRSISGLSQHKRIHT    421 - 490
GEKPYECKECDKAFNRSDRLTQHETIHTGVKPQKCKECGKAFSHCYQLSQHQRFHHGERLLM            491 - 552
//

Text Mined References (8)

PMID Year Title