Property Summary

NCBI Gene PubMed Count 13
PubMed Score 15.17
PubTator Score 38.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma -1.100 9.0e-04
interstitial lung disease 1.100 5.8e-03
Multiple myeloma 1.216 1.7e-02
malignant mesothelioma -1.600 9.5e-07
cutaneous lupus erythematosus -1.300 1.4e-03
glioblastoma multiforme 1.100 2.0e-11
osteosarcoma 2.237 9.2e-06
cystic fibrosis 1.953 5.5e-05
astrocytoma 1.400 4.7e-03
adrenocortical carcinoma 1.521 5.0e-03
primary pancreatic ductal adenocarcinoma -1.171 6.2e-03
interstitial cystitis -1.200 1.5e-05
posterior fossa group A ependymoma 1.100 7.9e-06
psoriasis -1.600 4.8e-11
inflammatory breast cancer -1.100 1.5e-02
breast carcinoma -1.100 1.7e-26
Pick disease 1.500 6.5e-04
invasive ductal carcinoma -1.500 2.7e-03
ovarian cancer -3.000 7.0e-10
pancreatic cancer -1.300 8.1e-04
dermatomyositis 1.600 3.8e-04

Gene RIF (9)

PMID Text
24599008 miR-525-3p promotes liver cancer cell migration and invasion by directly targeting ZNF395.
24086395 IkBalpha kinase (IKK)-signaling is necessary to allow ZNF395 to activate transcription and simultaneously enhances its proteolytic degradation.
23760207 Studies indicate that ZNF395 was strongly expressed in adipocytes, and suggest a role for ZNF395 as a modulator of adipogenesis.
23142027 ZNF395 coordinate the transcriptional regulatory pathway with PPARG2, which may be necessary for the genesis of adipocytes.
19018758 colocalization of PBF and Scythe/BAT3 in the nucleus might be an important factor for survival of osteosarcoma cells.
17897615 PBF binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex
17531190 PBF is a new cellular factor mediating the effects of PI3K/Akt signaling and 14-3-3 on cell growth
15289353 PBF is an osteosarcoma-associated antigen recognized by autologous cytotoxic T-lymphocyte clone in the context of HLA-B*5502.
14625278 HDBP1 and HDBP2 are novel transcription factors shuttling between nucleus and cytoplasm and bind to the specific GCCGGCG, which is an essential cis-element for HD gene expression in neuronal cells

AA Sequence

MASVLSRRLGKRSLLGARVLGPSASEGPSAAPPSEPLLEGAAPQPFTTSDDTPCQEQPKEVLKAPSTSGL      1 - 70
QQVAFQPGQKVYVWYGGQECTGLVEQHSWMEGQVTVWLLEQKLQVCCRVEEVWLAELQGPCPQAPPLEPG     71 - 140
AQALAYRPVSRNIDVPKRKSDAVEMDEMMAAMVLTSLSCSPVVQSPPGTEANFSASRAACDPWKESGDIS    141 - 210
DSGSSTTSGHWSGSSGVSTPSPPHPQASPKYLGDAFGSPQTDHGFETDPDPFLLDEPAPRKRKNSVKVMY    211 - 280
KCLWPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAAAAAAAAAGTPVPGTPT    281 - 350
SEPAPTPSMTGLPLSALPPPLHKAQSSGPEHPGPESSLPSGALSKSAPGSFWHIQADHAYQALPSFQIPV    351 - 420
SPHIYTSVSWAAAPSAACSLSPVRSRSLSFSEPQQPAPAMKSHLIVTSPPRAQSGARKARGEAKKCRKVY    421 - 490
GIEHRDQWCTACRWKKACQRFLD                                                   491 - 513
//

Text Mined References (17)

PMID Year Title
24599008 2014 MiR-525-3p enhances the migration and invasion of liver cancer cells by downregulating ZNF395.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086395 2013 The hypoxia-inducible transcription factor ZNF395 is controlled by I?B kinase-signaling and activates genes involved in the innate immune response and cancer.
23760207 2013 Emerging roles of zinc finger proteins in regulating adipogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23142027 2013 Identification of ZNF395 as a novel modulator of adipogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19018758 2009 Scythe/BAT3 regulates apoptotic cell death induced by papillomavirus binding factor in human osteosarcoma.
17897615 2007 Papillomavirus binding factor binds to SAP30 and represses transcription via recruitment of the HDAC1 co-repressor complex.
17531190 2007 Papillomavirus binding factor (PBF)-mediated inhibition of cell growth is regulated by 14-3-3beta.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15289353 2004 Identification of human autologous cytotoxic T-lymphocyte-defined osteosarcoma gene that encodes a transcriptional regulator, papillomavirus binding factor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625278 2004 Novel nuclear shuttle proteins, HDBP1 and HDBP2, bind to neuronal cell-specific cis-regulatory element in the promoter for the human Huntington's disease gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11853404 2002 A new cellular factor recognizes E2 binding sites of papillomaviruses which mediate transcriptional repression by E2.