Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.34
PubTator Score 1.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.700 4.3e-03
astrocytic glioma -1.400 1.4e-02
Astrocytoma, Pilocytic -1.500 3.5e-08
atypical teratoid / rhabdoid tumor -2.600 7.3e-09
ependymoma -1.600 1.7e-02
glioblastoma -1.200 8.8e-03
group 3 medulloblastoma -1.300 1.6e-03
interstitial cystitis 1.800 4.9e-05
intraductal papillary-mucinous adenoma (... -1.400 1.3e-04
intraductal papillary-mucinous carcinoma... -1.200 1.0e-03
intraductal papillary-mucinous neoplasm ... -1.500 2.0e-03
invasive ductal carcinoma -1.200 1.1e-03
medulloblastoma, large-cell -1.500 1.3e-03
oligodendroglioma -2.100 2.6e-03
pancreatic cancer 1.300 1.9e-03
pancreatic carcinoma 1.300 1.9e-03
primitive neuroectodermal tumor -2.000 2.6e-04
psoriasis -1.900 7.9e-05

Gene RIF (2)

AA Sequence

MRNIMYFGGTCQSPALPALVRPPAPPLQPSLDIKPFLPFPLDTAAAVNLFPNFNAMDPIQKAVINHTFGV      1 - 70
PLPHRRKQIISCNICQLRFNSDSQAAAHYKGTKHAKKLKALEAMKNKQKSVTAKDSAKTTFTSITTNTIN     71 - 140
TSSDKTDGTAGTPAISTTTTVEIRKSSVMTTEITSKVEKSPTTATGNSSCPSTETEEEKAKRLLYCSLCK    141 - 210
VAVNSASQLEAHNSGTKHKTMLEARNGSGTIKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSET    211 - 280
QLKQHISSRRHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVA    281 - 350
VSSPFSLRTAPAATLFQTSALPPALLRPAPGPIRTAHTPVLFAPY                             351 - 395
//

Text Mined References (16)

PMID Year Title