Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.36
PubTator Score 6.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -2.900 1.2e-03
posterior fossa group A ependymoma -4.400 1.7e-16
oligodendroglioma -2.600 1.4e-02
glioblastoma -4.200 2.3e-06
osteosarcoma 2.128 3.2e-02
sonic hedgehog group medulloblastoma -3.300 3.8e-04
atypical teratoid / rhabdoid tumor -2.500 1.5e-02
medulloblastoma, large-cell -3.100 7.1e-03
primitive neuroectodermal tumor -4.100 3.4e-05
non-small cell lung cancer -3.430 1.7e-26
interstitial cystitis -1.200 4.3e-03
lung adenocarcinoma -1.500 7.9e-08
adult high grade glioma -3.500 1.2e-04
pilocytic astrocytoma -3.000 1.6e-04
aldosterone-producing adenoma -1.370 2.7e-02
subependymal giant cell astrocytoma -3.594 1.4e-03
lung carcinoma -2.500 4.0e-20
Pick disease -1.300 1.0e-02
gastric carcinoma -3.600 6.3e-03
invasive ductal carcinoma -1.300 1.7e-02
ovarian cancer -1.300 4.0e-08
pituitary cancer 1.400 1.4e-03
psoriasis -1.200 3.7e-15

Gene RIF (8)

PMID Text
24599690 The study found significant associations between autism and two SNPs of the ZNF533 gene.
23029477 ZNF385B and VEGFA are strongly differentially expressed in serous ovarian carcinomas and correlate with survival.
22945289 The direct binding of ZNF385B with p53 has suggested the involvement of ZNF385B in B-cell apoptosis via modulation of p53 transactivation
20849254 the relationship between ZNF533, environmental factors, and the etiology of nonsyndromic orofacial clefts
20849254 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401682 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNMANFLRGFEEKGIKNDRPEDQLSKEKKKILFSFCEVCNIQLNSAAQAQVHSNGKSHRKRVKQLSDGQP      1 - 70
PPPAQASPSSNSSTGSTCHTTTLPALVRTPTLMMQPSLDIKPFMSFPVDSSSAVGLFPNFNTMDPVQKAV     71 - 140
INHTFGVSIPPKKKQVISCNVCQLRFNSDSQAEAHYKGSKHAKKVKALDATKNKPKMVPSKDSAKANPSC    141 - 210
SITPITGNNSDKSEDKGKLKASSSSQPSSSESGSFLLKSGTTPLPPGAATSPSKSTNGAPGTVVESEEEK    211 - 280
AKKLLYCSLCKVAVNSLSQLEAHNTGSKHKTMVEARNGAGPIKSYPRPGSRLKMQNGSKGSGLQNKTFHC    281 - 350
EICDVHVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQKDMMKPLAPAFLSSP    351 - 420
LAAAAAVSSALSLPPRPSASLFQAPAIPPALLRPGHGPIRATPASILFAPY                       421 - 471
//

Text Mined References (14)

PMID Year Title
26755636 2016 Exome sequencing and CRISPR/Cas genome editing identify mutations of ZAK as a cause of limb defects in humans and mice.
24599690 2014 Family-based association study of ZNF533, DOCK4 and IMMP2L gene polymorphisms linked to autism in a northeastern Chinese Han population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23029477 2012 ZNF385B and VEGFA are strongly differentially expressed in serous ovarian carcinomas and correlate with survival.
22945289 2012 ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20849254 2011 Significant evidence of association between polymorphisms in ZNF533, environmental factors, and nonsyndromic orofacial clefts in the Western Han Chinese population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.