Property Summary

NCBI Gene PubMed Count 44
PubMed Score 50.56
PubTator Score 25.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.700 2.3e-04
astrocytic glioma -2.600 1.2e-03
Astrocytoma, Pilocytic -1.500 7.1e-04
atypical teratoid / rhabdoid tumor -4.500 1.3e-10
ependymoma -3.900 9.3e-04
esophageal adenocarcinoma -1.500 2.3e-02
glioblastoma -2.500 2.5e-06
group 3 medulloblastoma -5.100 1.0e-05
medulloblastoma, large-cell -4.000 1.5e-04
oligodendroglioma -1.900 1.6e-02
ovarian cancer 1.100 3.4e-02
Pick disease -1.600 4.2e-02
pituitary cancer 1.200 5.1e-04
primitive neuroectodermal tumor -3.400 3.6e-05
psoriasis -1.300 3.5e-04

Gene RIF (18)

AA Sequence

MSALGQITITVSRCWNTERNQTDKNPCLHGAYLQLRETVKNKSTHLKKPLMKQAPPWKDHLTFQPLHPAE      1 - 70
RKTQVWRWQSGNSSDLETTSSASPWPTGSNRDVVLNTLAESCCGLSELITAPPYAGVSIQGFSQIWVLFP     71 - 140
FCGGTFHHNEKDVLGLQDFERESVSTSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGVICFPW    141 - 210
GLPSSS                                                                    211 - 216
//

Text Mined References (44)

PMID Year Title