Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.54
PubTator Score 8.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
cystic fibrosis 1696 1.4e-04
acute myeloid leukemia 783 1.1e-02
Rheumatoid arthritis 1191 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Seminoma 15 3.253 1.6
Renal clear cell carcinoma 6 3.014 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.200 1.1e-02
cystic fibrosis -1.400 1.4e-04
Rheumatoid arthritis 1.100 4.1e-02

Gene RIF (3)

AA Sequence

MAAGQREARPQVSLTFEDVAVLFTRDEWRKLAPSQRNLYRDVMLENYRNLVSLGLPFTKPKVISLLQQGE      1 - 70
DPWEVEKDGSGVSSLGSKSSHKTTKSTQTQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKG     71 - 140
SFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPREKTPPKCEIQGNSLKQNSQLLNQPKITA    141 - 210
DKRYKCSLCEKTFINTSSLRKHEKNHSGEKLFKCKECSKAFSQSSALIQHQITHTGEKPYICKECGKAFT    211 - 280
LSTSLYKHLRTHTVEKSYRCKECGKSFSRRSGLFIHQKIHAEENPCKYNPGRKASSCSTSLSGCQRIHSR    281 - 350
KKSYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCNECGKGFT    351 - 420
SISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTG    421 - 490
ERPYKCNECGKTFRCNSSLSNHQRIHTGEKPYRCEECGISFGQSSALIQHRRIHTGEKPFKCNTCGKTFR    491 - 560
QSSSRIAHQRIHTGEKPYECNTCGKLFNHRSSLTNHYKIHIEEDP                             561 - 605
//

Text Mined References (11)

PMID Year Title